KEGG   Oryza brachyantha (malo sina): 102702984Help
Entry
102702984         CDS       T02995                                 

Definition
(RefSeq) probable serine/threonine-protein kinase WNK8
  KO
K08867  WNK lysine deficient protein kinase [EC:2.7.11.1]
Organism
obr  Oryza brachyantha (malo sina)
Brite
KEGG Orthology (KO) [BR:obr00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:obr01001]
    102702984
   01009 Protein phosphatases and associated proteins [BR:obr01009]
    102702984
Enzymes [BR:obr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     102702984
Protein kinases [BR:obr01001]
 Serine/threonine kinases: Other
  Wnk family
   102702984
Protein phosphatases and associated proteins [BR:obr01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     102702984
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr OSR1_C APH Pkinase_fungal Kinase-like
Motif
Other DBs
NCBI-GeneID: 102702984
NCBI-ProteinID: XP_006663741
UniProt: J3NAS8
Position
12
AA seq 625 aa AA seqDB search
MSASGRCGGRRWERSTVVGDDRNGYVETDPTGRYGRLAEVLGKGAMKTVYRGFDEVRGVE
VAWNQATISDVLRTPDALHRMYAEVSLLADLRHDAIISFHASWVDPSPSRRSFNFITELF
SSGTLRSYRLRYPRVSRRAIAAWARHLLRGLAYLHSRGVIHRDLKCDNIFVNGHLGQVKI
GDLGLAAVLRGCSSAHSVIGTPEFMAPEMYDEHYGVGVDVYSFGMCMLEMLTNEYPYSEC
NNPAQIYKKVTAGKMPDAFYRLTDPEARRFIGRCLVAASHRPSAEELLIDPFLSPSQHHD
DHNSNVITCHSAPPPPPLPLITIANSEQEEGEEAPAAESTAVDMTITGKLNKEHDTIFLK
VQIGSDESSRDGHGGNVRNIYFPFDIVNDTAMEVATEMVKELDIGEREPREIAAMIEQEI
VRLVPGYKQQQQEYSYADDHDDDDDDGHPNPFYYLSSSPTSSQESLGRVGLTSSGGFPGP
HGKVDCSRDYCYYRPPSSSSVSVSDDDDCTASCPTSAGSQQQHCSSSSRLGPAAAAAERG
GHAGRPRQREGEEERRRRRMTRNRSMVDMRSQLLHRTLVEELNKRLFFNTVGAVHDIGFR
DPTTSSSQQHRRSHKHQHYMFSKSQ
NT seq 1878 nt NT seq  +upstreamnt  +downstreamnt
atgtccgcctcagggcgatgcggcggccgccggtgggaaagaagtacggtggtgggcgac
gacaggaatggatacgtcgagactgacccaactgggcgctatggccggttggcggaggtg
ctggggaagggggcgatgaagacggtgtaccgagggttcgacgaggtgcggggggtggag
gtggcgtggaaccaggccaccatctccgacgtcctccgcacccccgacgccctccaccgc
atgtacgccgaggtcagcctcctcgccgacctccgccacgacgccatcatctccttccac
gcctcctgggtcgacccttccccctcccgccgctccttcaacttcatcaccgagctcttc
tcctccggcaccctccgctcctaccgcctccgctacccgcgcgtcagccgccgcgccatc
gccgcctgggcgcgccacctcctccgcggcctcgcctacctccactcccgcggcgtcatc
caccgcgacctcaagtgcgacaacatcttcgtcaacggccacctcggccaggtcaagatc
ggcgacctcggcctcgccgccgtcctccgcggctgctcctccgcccacagcgtcatcggc
acgcccgagttcatggcccctgagatgtacgacgagcactacggcgtcggcgtcgacgtc
tactccttcggcatgtgcatgctcgagatgctcaccaacgagtacccctacagcgagtgc
aacaacccggcccagatatacaagaaggtcaccgccggcaagatgcccgacgccttctac
cgcctcaccgaccccgaagcccgccgcttcatcggccgctgcctcgtcgccgcttcccac
cgcccctccgccgaggagctcctgatcgaccccttcctctcgccgtctcagcaccacgac
gatcacaacagcaacgtgattacgtgtcattccgcccctccaccgccgccattgccactg
atcactattgccaatagtgaacaagaggagggggaggaggcgccggcagcagaaagtacg
gcggtggacatgacgatcaccgggaagctgaacaaagagcacgacaccatcttcctcaag
gtgcagatcggcagcgacgagtcatcacgtgatggtcatggcgggaacgtgcggaacatc
tacttcccgttcgacatcgtgaatgacacggcgatggaggtggcgacggagatggtgaag
gagctggacatcggcgagagggagccgagggagatcgcggccatgatcgagcaggagata
gtgaggttggtgccagggtacaagcagcagcagcaggagtactcgtacgcggatgaccac
gatgatgatgacgacgacggacaccctaatcccttctactacctctcctcgtcacccacc
tcctctcaggaatctctcggcagggtgggcctcacatcctcggggggcttccctggccca
catggcaaggttgactgctcaagagattactgttactaccgccctccaagcagcagcagc
gtgagcgtcagcgacgacgatgactgcacggcgagctgccctacaagcgctggaagtcag
cagcagcactgctcctcttccagcagattggggccagcagcagcagcagcagaaagagga
gggcacgccggacgcccgcggcagcgagagggagaggaggagcggcggcggcggaggatg
acgaggaacaggtcgatggtggacatgcgaagccagctgctgcaccggacgctggtggag
gagctcaacaagcgcctcttcttcaacaccgtcggcgccgtccatgacatcggcttccgc
gaccccaccacctcctcctcgcagcaacatcgccggagccacaagcaccaacactacatg
ttctcaaaatctcaataa

DBGET integrated database retrieval system