KEGG   Oryza brachyantha (malo sina): 102705352Help
Entry
102705352         CDS       T02995                                 

Definition
(RefSeq) probable methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
obr  Oryza brachyantha (malo sina)
Pathway
obr00450  Selenocompound metabolism
obr00970  Aminoacyl-tRNA biosynthesis
obr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:obr00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    102705352
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    102705352
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:obr01007]
    102705352
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:obr03016]
    102705352
Enzymes [BR:obr01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     102705352
Amino acid related enzymes [BR:obr01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   102705352
Transfer RNA biogenesis [BR:obr03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    102705352
 Prokaryotic type
   Other AARSs
    102705352
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind Anticodon_1 Viral_protease
Motif
Other DBs
NCBI-GeneID: 102705352
NCBI-ProteinID: XP_006656115
Position
6
AA seq 727 aa AA seqDB search
MEEKCSPKEICDKYHAVHSEVYKWFDIKFDKFGRTSSPQQTEVCQAIFRKLMENNWLTEN
TMQQLYCDTCQRFLADRLVEGKCPTEGCNYEAARGDQCENCSKLLNPTELIDPKCKVCKN
TPRIRDTDHLFLELPLLKDKLVNYINETSVTGMWSQNAIQATNAWLKEGLKSRCITRDLK
WGVPVPHEKYKDKVFYVWFDAPIGYISITASYTPDWEKWWKDPENVELFQFMGKDNVPFH
TVMFPSTLLGTGEKWTMMKTISVTEYLNYEAGKFSKSHGIGVFGNDAKDTNIPPEVWRYY
LLTNRPEVSDTLFTWADLQAKLNSELLNNLGNFINRVLSFVAKPAGAGYDSIIPDAPNAE
SHPLTKALAEKTNKWVEQYLEAMEKVKLKQGLKSAMGISSDGNAYLQESQFWKLYKEDPA
ACAVVMKTSVGLVYLLACLLEPFMPSFSIEVLRQLNLSPEESLSFCDNKGESAKAERPWE
FVPAGHKIGKPSPLFKELKDEEVESFRNRFAGSQAERNSKAQADAEAKKVADKLKGTKLS
EGGQKKEQKKQSGGSKSKNAEVDVTVAKLDIRVGLIRKAEKHPDADSLYVEEIDVGEEAP
RTVVSGLVKYIPLEEMQNRKVCVLCNLKPVAMRGIKSHAMVLAASNEDHTKVELVEPPES
AAVGERVTFAGYSGEPEASLSGKSKTWEKLSADLHSNGELVACYKDVAFTTSAGVCKVKT
IANGEIR
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
atggaggagaagtgctcgcccaaggagatctgcgacaagtatcatgctgtccatagtgag
gtttacaagtggtttgacataaagtttgacaagtttggccggacttcctctcctcaacag
actgaagtctgtcaagcaattttccgaaagttgatggaaaacaattggctcacagaaaat
accatgcagcagttatactgtgatacttgccaacggtttttagcggataggcttgtagaa
gggaaatgcccaactgaaggctgtaattatgaggcggcgcgtggtgatcagtgtgaaaac
tgcagcaaattgttgaatccaactgagctcattgatcccaagtgtaaggtctgtaagaat
actccacgtatccgtgacacagatcacttattccttgagcttcctcttttgaaagacaag
ttggtaaactatatcaatgaaacttctgtaactggtatgtggagtcaaaatgctattcaa
gcaacaaatgcatggctcaaggaagggttgaagtcacgctgtatcacccgagatctgaaa
tggggagttcctgttccacatgagaaatataaggacaaggtgttctatgtttggttcgat
gcgccaattggctatatatctatcacagcttcttatacacctgattgggagaaatggtgg
aaggatcctgaaaatgttgaattgtttcagttcatgggtaaagataatgtgccatttcac
acggttatgttcccttctacattacttggaaccggtgaaaagtggacaatgatgaagacc
atcagtgtgactgaatatttgaactacgaagcaggaaaattctccaagagccatggtatt
ggagtctttggtaatgacgcgaaagatacaaatattcctcctgaagtgtggcgatactac
ttgcttacaaatcgtcctgaggtatcagatacactgtttacttgggctgatttgcaagca
aagttaaacagtgaattgctaaacaatttgggaaacttcatcaaccgtgtgctcagtttt
gttgcgaaaccagctggagctggatatgattccatcatacctgatgctcctaatgctgag
tcgcatccactgacaaaggcacttgcggagaaaactaataaatgggttgaacaatatctt
gaagcaatggaaaaggttaaattgaaacaaggactaaagagcgccatgggcatttctagt
gatggaaatgcatatctgcaagagagccagttttggaaactttataaggaagatccggca
gcctgtgctgttgtaatgaaaacttcagttggtctggtctatctccttgcctgtttactg
gaacctttcatgccttcattttccattgaagtattgcggcaattaaatttgtcccctgag
gaaagcttgtctttctgtgacaataaaggagaaagtgccaaagcagaaagaccgtgggag
tttgtaccagcaggccacaaaataggaaagccttcacctctatttaaggaactgaaagat
gaagaggtagagtccttcaggaatagatttgcaggcagccaagctgaaaggaactcaaag
gcacaggctgatgctgaagctaagaaggtagctgacaagcttaagggcacaaaattatct
gagggaggtcaaaagaaggaacagaagaaacaatccggtggttcaaaatcaaagaacgca
gaggtggatgtgacggttgcaaagttggacattcgagtggggcttatcaggaaagcagag
aagcatccagacgctgattcgctgtatgtagaagagattgatgttggagaggaggcacca
agaacagttgttagcggccttgtcaaatacatccctcttgaagaaatgcagaaccggaaa
gtgtgtgttctctgcaatcttaagccagtggcaatgcgcggtataaaatcacatgcaatg
gtacttgctgcatcaaatgaggaccatacaaaggttgagttggttgagccaccagaatca
gcggcagttggggagagggtgacctttgctgggtactctggagagcctgaggcctcactg
agtggaaagagcaagacgtgggagaagttatcagctgacctgcacagcaacggcgagctt
gtggcatgctacaaggatgtagccttcacaacttcagctggagtttgcaaggtgaagaca
attgcgaatggagaaattcgctag

DBGET integrated database retrieval system