KEGG   Oryza brachyantha (malo sina): 102705484Help
Entry
102705484         CDS       T02995                                 

Definition
(RefSeq) glutathione S-transferase-like
  KO
K01800  maleylacetoacetate isomerase [EC:5.2.1.2]
Organism
obr  Oryza brachyantha (malo sina)
Pathway
obr00350  Tyrosine metabolism
obr01100  Metabolic pathways
Module
obr_M00044  Tyrosine degradation, tyrosine => homogentisate
Brite
KEGG Orthology (KO) [BR:obr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    102705484
Enzymes [BR:obr01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.2  maleylacetoacetate isomerase
     102705484
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C_2 GST_C_3
Motif
Other DBs
NCBI-GeneID: 102705484
NCBI-ProteinID: XP_006663904
UniProt: J3NC44
Position
12
AA seq 212 aa AA seqDB search
MASSKPILYGAWISSCSHRIRIVLNLKGVDYEYKSVNPRTDPDYEKINPIKYIPALVDGD
IVVSDSLAIALYLEDKYPQHALLPKDLKKKALNLQIANIVCSSIQPLQGYAVIGLHEGKL
SPDESLQIVQHYIDKGFKAIEKLLEGCSFKYATGDEVQLGDVFLAPQIHAGINRFQIDIT
KYPILARLHDIYMENPEFQAAVPKNQPDAPSC
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcgtcgaagccaatcctgtatggtgcctggatcagctcttgctctcaccgaatc
cggatcgttctcaaccttaaaggtgtggattatgagtacaagtctgtcaaccctcgcaca
gatccagactatgaaaaaatcaatccaatcaagtacataccagcattagtagatggagac
atagtcgtttctgactctctcgctattgcattgtatcttgaagataaatatcctcaacat
gctctcctacctaaggatctcaaaaagaaagctcttaatcttcagattgcaaacatagtt
tgttcaagcatccaacctcttcaaggctatgctgtaattggtttgcacgagggtaagcta
agccctgatgagagtcttcagatagtccagcattatattgataagggcttcaaagcgatc
gaaaagcttttagaaggatgcagctttaaatatgctactggtgacgaagttcaattgggg
gatgtttttctagcaccacagatccatgcgggtataaatcgcttccaaattgatatcaca
aagtacccaattttggcaagacttcatgacatttacatggaaaatcctgaatttcaagct
gcagttccaaaaaatcagccagatgcaccttcatgctaa

DBGET integrated database retrieval system