KEGG   Oryza brachyantha (malo sina): 102708193Help
Entry
102708193         CDS       T02995                                 

Definition
(RefSeq) polygalacturonase-like
  KO
K01184  polygalacturonase [EC:3.2.1.15]
Organism
obr  Oryza brachyantha (malo sina)
Pathway
obr00040  Pentose and glucuronate interconversions
obr01100  Metabolic pathways
Module
obr_M00081  Pectin degradation
Brite
KEGG Orthology (KO) [BR:obr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    102708193
Enzymes [BR:obr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.15  endo-polygalacturonase
     102708193
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_28 Beta_helix Glug
Motif
Other DBs
NCBI-GeneID: 102708193
NCBI-ProteinID: XP_006663339
Position
11
AA seq 270 aa AA seqDB search
TLDGNGRSFWACKAAAGRDCPPGTTTLDISQSNNVSVKRVTLVDSKNVHVSIFDCAGVTL
QGLRITAPADSPNTDGIHVALSRDVSILSATVGTGDDCVSMGPGTSGVVLRSIRCGPGHG
ISIGSLGGGAGEGEVRNVTVESAVLTGTQNGLRIKTWGKPNAGRVAGVRFTRVAMRGVGN
PIVVDQNYCPGNVNCPGQSSGVKISDVEYDDITGTSATEVAVKFDCSGSNPCTGIRLKNI
NLTYDGKPAQSFCKNAGGGASGAVSPPSCL
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
acgctcgatggcaacggccgctccttctgggcctgcaaggccgccgctggccgcgactgc
ccgcccggcaccaccacgctggacatcagccagtcgaacaacgtgtccgtgaaacgggtg
acgctggtggacagcaagaacgtccacgtgtccatcttcgactgcgccggcgtgacgctc
cagggcctcaggatcaccgcgccggcggacagccccaacaccgacggcatccacgtggcg
ctctcccgcgacgtctccatcctcagcgcgacggtcggcaccggcgacgactgcgtctcc
atggggccgggcacctccggcgtggtcctccgcagcatccggtgcggcccgggacacggg
atcagcatcggcagcctcggcgggggcgccggcgagggggaggtccgcaacgtgacggtg
gagtccgcggtgctcaccggcacgcagaacggcctccggatcaagacgtgggggaagccc
aacgccggccgcgtcgccggcgttaggttcacccgcgtcgccatgcgcggggtcgggaac
cccatcgtcgtcgaccagaactactgccccggcaacgtcaactgccccggccagagctcc
ggcgtgaagatcagcgacgtggagtacgacgacatcacggggacgtcggcgacggaggtg
gcggtgaagttcgactgcagcggcagcaacccgtgcacggggatcaggctcaagaacatc
aacctgacgtacgacggcaagccggcgcagtcgttctgcaagaacgccggcgggggggcg
tccggcgccgtcagcccgccgagctgcctctga

DBGET integrated database retrieval system