KEGG   Oryza brachyantha (malo sina): 102708382Help
Entry
102708382         CDS       T02995                                 

Definition
(RefSeq) glutamyl-tRNA(Gln) amidotransferase subunit B, chloroplastic/mitochondrial
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
obr  Oryza brachyantha (malo sina)
Pathway
obr00970  Aminoacyl-tRNA biosynthesis
obr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:obr00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    102708382
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:obr03029]
    102708382
Enzymes [BR:obr01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     102708382
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     102708382
Mitochondrial biogenesis [BR:obr03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    102708382
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-GeneID: 102708382
NCBI-ProteinID: XP_006662992
UniProt: J3N8W5
Position
11
AA seq 548 aa AA seqDB search
MALTLLRGIRTPMVARRNAGLFFTTLQTPLSRFATRAESAQATEPKPPAPKSIQLATKEA
AEQKTQGFEAVIGIETHVQLSTVTKAFCSCLYSYGSQPNSTVCPTCMGHPGTLPVLNAKV
VECAVKLGLALNCEIAMTSKFDRKQYFYPDLPKGYQISQFDIPIAKEGYLDLDLPMEFGG
GHRRFGITRVHMEEDAGKLLHSESGSYSQVDLNRAGVPLLEIVSEPDMRTGIEAAEYGAE
IQRLVRYLGVSNGNMQEGSLRCDVNVSVRPIEQSKFGTKVEIKNMNSFSAINRAIDYEIS
RQILLHKEGQADQIVQETRLWDESSQKTFTMRKKEGLADYRYFPEPDLPEIVLNSDYIDE
IQKSMPELPEAKRRRYENMGLSMQDVLFLANDDNVARFFDSTLGHGADAKLAANWIMGDI
AAYLKNEKLTIDEIKLTPLELSELIASIKNGTISGKIGKEILIELIAKGGTVKSVIEEKD
LVQIVDPAAIEAMVDQVLADNPKQLEQYRSGKTKLQGFFAGQVMKASKGKANPVLLNKIL
GEKLKASS
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atggcgctcacgcttctccgagggatccgaacaccaatggtagctaggaggaacgctgga
ttgttcttcaccaccttgcagaccccgttgtcccgcttcgcgacgagggcagagagcgcg
caggctaccgagcccaaaccaccggcgcccaagtcgattcagctggcgaccaaggaggcg
gcggagcagaagacgcagggcttcgaggcggtcatcgggatcgagacccatgtccagctc
tcaacggtcacgaaggcgttctgctcctgcctctacagctacgggtcgcagccgaacagc
accgtgtgccctacctgcatggggcaccccgggacgctgcccgtgctgaatgcgaaggtt
gtcgaatgcgcagtgaagcttggcctcgctctcaactgcgagatcgcgatgacgtccaag
tttgatcggaagcagtacttctacccggacctgcccaagggctaccagatttcgcagttt
gacattcccattgccaaggagggttaccttgatttggatcttcctatggagtttggcggt
gggcataggagatttgggatcacaagggtgcatatggaagaagatgctggcaagctgctt
cactctgaatccgggagttactctcaggttgacttaaatagggctggtgttcctttgctt
gaaattgtctcagagccagatatgagaacagggatagaggctgccgagtatggtgctgag
atacagaggctggttaggtatctgggcgtgagtaacggtaacatgcaggaaggttccctt
cgctgtgatgtgaatgtttctgttcggccaattgaacaatcaaaatttggtacgaaggtt
gaaataaagaatatgaactcattttctgcaataaatagggcaatagattatgagatctcc
cggcagattcttcttcacaaagaaggccaggctgatcaaattgtacaagaaacccgcctg
tgggatgaatcctctcagaaaacttttacaatgcgaaaaaaggagggacttgctgattac
agatattttcctgagcctgatcttccagaaattgttcttaatagtgactacattgatgaa
attcaaaagtcaatgccagagcttccagaagcaaaacgtaggcgctacgagaatatggga
ctcagcatgcaagatgttcttttccttgctaatgacgataatgttgctcgattcttcgac
tctactcttgggcatggcgctgatgcaaagctggctgccaactggatcatgggtgacatt
gctgcttatttgaaaaatgaaaaacttaccattgatgagattaaattgacacctctggag
ctttctgaactgatcgcgtctataaagaacggaactatcagcgggaagattggcaaggag
attctgattgaactcattgccaaaggtggaaccgtcaagtctgtgatagaggagaaagat
ttagttcagatagtagatcctgcagcaatcgaggcaatggtggatcaggtattagctgac
aacccaaagcaacttgagcagtatcggtccggtaaaactaagttgcaaggattttttgct
ggccaggtgatgaaagcatcaaagggtaaagccaaccctgttttgttgaacaaaatcctt
ggggagaaattaaaggccagtagttga

DBGET integrated database retrieval system