KEGG   Oryza brachyantha (malo sina): 102712072Help
Entry
102712072         CDS       T02995                                 

Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
obr  Oryza brachyantha (malo sina)
Pathway
obr00010  Glycolysis / Gluconeogenesis
obr00562  Inositol phosphate metabolism
obr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:obr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    102712072
   00562 Inositol phosphate metabolism
    102712072
Enzymes [BR:obr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     102712072
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     102712072
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-GeneID: 102712072
NCBI-ProteinID: XP_015691306
Position
3
AA seq 512 aa AA seqDB search
MAAAPRAPLPLALLVVSAALLAGASLSPAVEAGAFDVRRHLSTVTRYDVARGSNSVVSAP
SMSDECRVIHLNLVARHGTRAPTKKRIKELDRLAVRLKALIHEAKQAPESDSMKNIPSWI
KGWESPWKGRVKGGELVSEGEEELYNLANRVKERFQGLFDEEYHPDVYSIRATQVPRASA
SAVAFGLGLLSGKGKLGPVKNRAFSVLSESRASDICLRFFDSCETYKDYRKRKEPDVEKQ
KEPILEHVTSALINRYHLNFTTQDASSLWFLCKQEASLLNITNQACQLFNEAEVSFLEWT
DDLEGFVLKGYGESINYRMGLPLLKDVVQSMEEAIIAKEENHPDGTYEKARLRFAHAETV
VPFSCLLGLFLEGSDFEKIQREESLDIPPIPPQGRNWKGSVVAPFAGNNMLALYQCPRKT
GGSKISQDQKNSYFVQVLHNEAPVSMPGCGSKDFCPFEEFKEKIVEPHVKHDYDALCKIR
PVAREEPSSFSSRMWNFVLGLFSQNGDKKTEL
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atggctgctgctccccgcgcgcctctccccctcgccctcctcgtcgtctccgccgcgctc
ctcgcgggggcttccctctcgccggcggtcgaggccggcgcgttcgacgtccgccgccac
ctctccaccgtcaccaggtatgatgtagcgaggggatccaatagcgtggtatctgcgccg
tctatgtcggatgagtgccgcgtgatccacctcaatctcgtggcaaggcatggtactcgt
gctcctaccaaaaagagaatcaaagagctggatagactagcagttcggttgaaggctctt
atccatgaggcaaaacaagctcctgagagcgattctatgaagaacattccgtcatggatt
aaggggtgggagtctccctggaagggcagggtgaaaggtggtgagctggttagtgaaggg
gaggaagagctgtataaccttgccaacagagtcaaggagaggtttcaaggtctatttgat
gaggaatatcaccctgatgtgtattcaattagagcaactcaggttcctcgggcatcagct
agcgcagtagcatttggtttgggtctactttctgggaaagggaagcttggaccagtgaaa
aaccgtgccttttctgttctaagtgagagccgagcaagtgatatttgtctacgattcttt
gatagctgtgaaacgtacaaggactacaggaaaagaaaagagcctgatgttgaaaagcaa
aaggaaccaattttagaacacgttacatcagcattaatcaaccgttatcacctcaatttt
acaacacaagatgcttcttcgctctggttcctttgtaagcaggaagcgtctttactgaat
ataaccaatcaagcctgtcaactttttaatgaagctgaggtttcttttctagagtggaca
gatgatctggagggttttgtgctaaaaggatatggtgagtcaataaactataggatggga
ctaccgttgctcaaggacgttgtccagtcaatggaagaagcgatcatagctaaagaagaa
aaccaccctgatggtacatatgagaaggcaaggctccgatttgcacatgcagaaactgtt
gtgcctttctcatgtcttcttggtctttttctcgaaggatcagattttgagaagatacaa
cgggaggaatcgttggacatacctcctatcccaccacagggaagaaattggaagggcagt
gttgtagcaccttttgctggtaacaatatgttggctttgtaccagtgcccaagaaaaact
ggtggcagtaagatttcccaggatcaaaagaactcatactttgtgcaggttctacacaat
gaagctccagtgtcaatgccgggatgcgggagcaaagatttctgcccattcgaagaattt
aaggagaagatagttgaaccacacgtgaagcatgactacgacgccctatgtaagataagg
ccggtggcaagagaggagccttcttctttcagttccaggatgtggaatttcgtcctaggt
ttattctctcagaatggagataagaagacggagctgtag

DBGET integrated database retrieval system