KEGG   Oryza brachyantha (malo sina): 102713654Help
Entry
102713654         CDS       T02995                                 

Definition
(RefSeq) ATP-dependent RNA helicase DEAH11, chloroplastic-like
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
obr  Oryza brachyantha (malo sina)
Pathway
obr03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:obr00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    102713654
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:obr03041]
    102713654
Enzymes [BR:obr01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     102713654
Spliceosome [BR:obr03041]
 Complex C
  Other components
   Step II factors
    102713654
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Helicase_C IBR OB_NTP_bind HA2 DEAD zf-RING_UBOX RRM_1 zf-C3HC4_2 zf-C3HC4 AAA_19 AAA_30 AAA_22 ABC_tran AAA_29 AAA_25
Motif
Other DBs
NCBI-GeneID: 102713654
NCBI-ProteinID: XP_015694730
Position
7
AA seq 1693 aa AA seqDB search
PRQFAVNLLRGGSNLSAPPATEVEALVAGLTSPPPDNLSVCSSGRLAARLLFRSLPAAAA
AAHELWSLRLEGLHLLTPDVPYPALASHAAPLIASLFAAHTSRLIDSDLVSLTAARSSEL
AASIQTVKRRLAARNRIGDFEQLQVQKRTLEAEKDLVDAKIAEYKAAMRSIRRALLRGME
DKDEEAEAEEGLEVFGIGGGGEMNFARLHMIMLRECRRLKEGLPIYAYRRNIVDHIFANQ
VMILIGETGSGKSTQLVQYLADSGLAANGSIICTQPRKIAAMSLAHRVNEESTGCYGNNF
VLSYSTFLDYHDFSSKIIYTTDNCLLHFCMNDMGLDGISYIIVDEAHERSLNTDLLLALI
KKKLLDRLDLRLIIMSATADSNRLAEYFYGCQTFHVKGRSFPVEIKYVPDLSEEASFNTV
PNHLRGSCATASYVYDVVRMVGIIHKNEEEGAILAFLTSQLEVEWACENFSDADAVVLPM
HGKLSHVEQSLVFKSYHGKRKIIFCTNIAETSLTIQEVKYVVDSGLAKESRYVPSSGLNV
LKVNWISQSSANQRAGRAGRTAAGRCYRLYSESDFSMMEVHQEPEIRKVHLGTAVLRILA
LGIRDVQSFEFVDAPNPEAINMAVKNLEQLGAVEYKCDGYELTDTGRHLVKLGIEPRLGK
IMLDCCSFGLRKEGVVLAAVMANSSSIFCRVGTDEVKNKADRLKVPFCHQDGDLFTLLAV
YKEWEDAHENRNMWCWQNSINAKTMRRCQETISELENCLKHELNIIVPSYWCWNPEESTE
HDKLLKKIILTSLSGNLAMFSGHERFGYQVISTDQAVKLHPSCSLLIYNSKPEWVVFTEI
LSVPNQYLVCVTAVDPDALCMIHPMPLIQRLEKHKLQVKVISGLGNNLLRRFCGKSGQNQ
QKIISFLQQEFRDDRVTVEVDFRNNEVVLFAKEQDIEKVFGIVNDAVECEAMMLRNECLE
KSLFPGKPGDCSLALFGSGAEIKHLELEKRCLTVEVLHQNACELNDKELIRLVDTLISGV
ANFYKLFGNLQVASDETKWGKFTFLNPEYAEDAVSKLNGMEFHGSPLKVVQVCSFNNRGL
PFPAVRAKVSWPLKRSRGLALVTCANGEAEFIVKDCFALAVGGRYINCEVSTRHENCIFV
KGIPLHVTEPELYDAFRSTTTRTIVDIHLLRGTPIAPPSASLCAEALIREISSFMPKKNF
PAQNFRVEVFPPEENDSVMRATITFDGSLHREAARALEHLEGHVLPCCLPWQIIQCQHVF
HSTVSCPVRVYNVISQAVASLLESFRSQKGVSYNLEKNEYGIFRVKLTANATKTIADLRR
PLEILMKGKTINHPDLTLSAVQLLMSRDGVADLKSVEQETSTYIMYDRQSLNIKIFGLQD
QVAAAEEKLVHALRQLCENKPLDIRLRGRNLPPNLMKKILKKFGADLEGLKRDVPAADLR
LNLRHHTLYVRGSKEDKQRVEELISEVVTSNTHNGLVQLPLENACPICLCEVEDPFKLES
CGHTFCLTCLVDQCESAMKSHDGFPLCCLKDGCKKQLLVVDLRCLLSSEKLEELFRASLR
SFVASNAGRYRFCPTPDCPSIYQVASANAESKPFVCGACFVEICNKCHIEYHPFISCETY
KEYKEDPDATLLEWRKGKDNVKVCPSCGFTIEKADGCNHVECRCGSHICWACLESFRSSD
ECYGHLRSVHLSY
NT seq 5082 nt NT seq  +upstreamnt  +downstreamnt
ccgcggcagttcgctgtgaatctcctccgggggggttccaacctctcggccccaccggcc
acggaggtggaggccctcgtcgcgggcctcacgtcccctcccccggacaatctgtcggtg
tgctcgtccggccgcctggccgcgcgcctcctcttccgctccctgccggcagccgccgcc
gccgcgcacgagctgtggtcgctccgcctcgagggcctccacctcctcacgccggacgtc
ccctatcccgccctcgcctcccacgccgcccccctcatcgcctctctcttcgccgcccat
acctcccgcctcatcgactccgacctcgtctctctcacggccgcccgctcctccgagctt
gcggcctccatccagacggtgaaacgccgcctggcagcacgcaatcgcattggtgacttt
gaacagctgcaggtccagaagagaacactcgaggctgagaaggacttggtagatgccaaa
attgccgagtacaaagctgcgatgaggtcgatacgacgtgcattgttgcgtgggatggag
gataaggacgaggaggcggaggcggaggaaggtttggaggtgtttgggattgggggtggt
ggtgagatgaactttgctaggctgcacatgataatgctgcgggaatgtagaaggcttaag
gaggggctacccatctacgcttatcgcaggaacattgtagatcacatttttgctaaccag
gtaatgatcttgattggggaaactggctctgggaagagcacacagttggttcagtatctt
gctgattcaggtcttgctgctaatggctcaattatctgtactcaacctcgcaaaattgca
gctatgtcattggcacacagagtaaatgaagaaagcaccggctgctatggcaacaacttt
gtgctatcatattcaacctttttagattatcatgacttcagttcaaagattatatatacc
acagataactgccttttgcatttctgcatgaatgacatgggactggatggcatttcatat
attattgttgatgaagctcatgaacgaagcttgaacactgaccttctgttagctttgatt
aagaagaaactgcttgataggcttgatttgagacttattataatgtctgccacagctgat
tctaatagacttgctgagtatttctatggctgccaaacatttcatgttaaagggcgaagt
ttccctgttgaaattaaatatgtcccagatctatcagaagaagcttccttcaataccgtg
ccaaaccatctgcgtggttcttgtgctactgcttcgtatgtttatgatgttgtgagaatg
gtaggcatcattcacaagaatgaagaagagggtgctatccttgctttcttgacttctcaa
ctcgaagttgaatgggcatgtgaaaacttcagcgatgcggatgctgtggtacttccgatg
catggaaagctttcccacgtagagcaaagtctagttttcaagagctatcatgggaagaga
aaaataatcttctgcacaaatatagctgaaacatcattgaccatacaagaagtgaagtat
gttgttgattctggattagctaaggagagcagatatgtgcctagtagtggtctgaatgta
ctaaaagtcaattggatctcccaaagttctgctaatcagcgcgctggtcgagcaggtcgg
actgcagcagggaggtgttacaggctttactctgaatctgacttcagtatgatggaagtg
catcaagaacctgaaatccgtaaagttcatcttggcactgctgttctgagaattcttgcg
ctaggtattagggatgtacagagctttgaatttgttgatgccccaaacccagaagccatt
aatatggctgtgaagaatcttgaacaactgggtgctgtggaatataaatgtgatggctat
gagctgactgatactggtcgccacctggttaaattgggaattgaaccaaggcttggaaaa
atcatgcttgattgctgtagttttggtttgaggaaggaaggtgtagtcctagctgctgtt
atggcgaattctagcagcatattttgtagagtgggcacagatgaggtgaaaaacaaagct
gaccgtctaaaggtcccattctgtcatcaagatggagatctgttcactttactagctgta
tataaggagtgggaggatgcacatgaaaacaggaatatgtggtgctggcagaatagcatc
aatgccaagaccatgaggaggtgccaggaaacaatatcagagcttgagaattgtttaaaa
catgagttaaacatcattgtcccaagttactggtgttggaaccctgaggagtccactgag
catgataagttgctaaaaaaaattattctcacatctctttctggtaatcttgctatgttt
tctggacacgaaaggtttggttaccaggtgatttcgacggatcaggctgtgaaacttcat
ccctcttgctcattgctcatttataacagcaaacctgagtgggtagtgtttacggaaata
ttgtcagtaccaaatcaatatttggtatgtgtaactgctgttgatcctgatgctttgtgt
atgattcatcccatgcctttgattcagcgtctggagaagcataaattgcaggtgaaggtc
attagtggacttggaaataatttgttgaggagattttgtggaaaatcaggccaaaatcag
cagaagataatctcatttctccagcaagaattcagggatgaccgtgtgactgttgaggtt
gacttcagaaataatgaggttgtgctatttgctaaagaacaagacatagaaaaggtgttt
ggcatcgttaacgatgcagtggaatgtgaagctatgatgttgaggaatgagtgccttgag
aaaagtttatttccaggaaaacctggcgattgttctcttgccttgtttggctcaggtgct
gaaatcaagcatttggaacttgagaagaggtgtctgacagtagaggttttgcatcaaaat
gcttgtgagttgaatgacaaggagcttattcgcttggtggatactcttatctctggtgtt
gctaatttttataagctctttggaaatcttcaggtggcctcagatgaaacaaagtggggg
aagtttacattcctcaatcctgaatatgctgaagatgctgtttcaaaattgaatgggatg
gaatttcatggttctccattgaaggtggttcaagtatgctccttcaataatcgaggatta
ccatttccagcagtaagagctaaagtatcttggccacttaagcgaagccgaggactcgcg
ctagtaacatgtgctaatggggaagctgaatttattgtaaaggattgctttgctctggca
gttggtggaaggtatatcaactgtgaggtcagtacgaggcatgagaattgtatttttgtc
aaaggaattccgttgcatgtaacagagccagaactgtatgatgcttttcgtagcacgaca
acaaggacaattgttgacatacatttgctcaggggaacacctatagctcccccctctgct
tctttgtgtgcagaagcactaattagagaaatttcttccttcatgccaaagaaaaatttt
cctgcccaaaatttccgcgttgaggtgttccctccagaggagaatgattcagtgatgaga
gccactattacatttgatggaagtcttcatcgagaggctgcaagagcattggagcatctt
gaaggacatgttcttccatgttgtcttccttggcagataatacaatgccagcatgttttt
catagtacagtctcctgtccagtacgtgtgtataatgttatcagccaagcagtcgcttct
ctgcttgagagcttccgaagccaaaaaggtgtgtcttacaacttggagaagaatgaatat
ggtatattccgtgtcaagcttactgcaaatgccacaaaaacaatagccgacttgagaagg
cctcttgagattttaatgaaaggcaaaactataaaccatcctgacctgacattaagtgca
gttcagttgctcatgtcccgtgatggtgtagcagatttgaaatccgttgagcaagagact
agcacttacattatgtatgacagacaaagtctaaatattaaaatctttgggctccaagat
caggtggctgcagcggaggagaaattggtccatgcacttcgacaactctgtgaaaacaag
cctctggatattcgtcttcgtggccgtaacctacctccaaacttgatgaagaaaatatta
aaaaagtttggggctgatctggaaggactcaagagagatgtacctgcagcagaccttcga
ttgaatttacgacaccatacactttatgttcgaggtagtaaagaagacaagcaaagggtg
gaagaactgatctctgaggtggtaacatctaatacacataatggcctggttcaacttcca
ttagagaatgcatgccctatttgcttgtgtgaggtagaagatccttttaagcttgaatct
tgtgggcacacattttgtctgacttgcttggtggatcagtgtgaatctgctatgaaatcg
catgatgggttccctctatgttgtctcaaagatgggtgcaagaagcagctccttgttgtt
gatttgagatgtctcctatcgagtgagaaactggaagagctattcagagcctccttgaga
tcatttgttgcctctaatgctggaagataccgtttctgtcctactcctgattgcccatcc
atttaccaggtggcttctgcaaacgctgaaagcaaaccttttgtctgcggggcttgcttt
gtggagatttgcaacaagtgtcatatcgaatatcatcctttcatatcctgcgagacatac
aaagaatacaaggaagaccctgatgcaactctgcttgaatggcgcaagggaaaggataat
gtaaaggtatgcccgtcttgtggctttacaatcgaaaaagctgatggctgtaaccatgtc
gagtgtagatgtggcagtcacatttgttgggcatgcttggagagcttcaggagcagtgat
gagtgttatggccatctcaggtctgtacacctatcctattag

DBGET integrated database retrieval system