KEGG   Oryza brachyantha (malo sina): 102714404
Entry
102714404         CDS       T02995                                 

Definition
(RefSeq) delta(14)-sterol reductase
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
obr  Oryza brachyantha (malo sina)
Pathway
obr00100  Steroid biosynthesis
obr01100  Metabolic pathways
obr01110  Biosynthesis of secondary metabolites
Module
obr_M00917  Phytosterol biosynthesis, squalene 2,3-epoxide => campesterol/sitosterol
Brite
KEGG Orthology (KO) [BR:obr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    102714404
Enzymes [BR:obr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     102714404
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295
Other DBs
NCBI-GeneID: 102714404
NCBI-ProteinID: XP_006661554
UniProt: J3N079
Position
9
AA seq 367 aa
MEHVAAALVPSWRAVVVLFSYLAYLAAAGAILPGKLVPGAVLPDSSRLHYRCNGLLSLFL
LLGLSSLGVYMGWMSPTVIADRGIELLSATFIFSVIVTFLLYYSGLRSHHKSSSLKPHVS
GSFIQDWWLGVQLNPHFMGVDLKFFFVRAGMMAWLFINLSLFAKSYLAGSANLSVILYQF
FCVWYIVDYFVHEEFMTSTWDIIAERLGFMLVFGDLVFIPFTFTIQGWWLLRNKVELSHL
AAIVNCTIFVIGYLVFRGANKQKHVFKKNPKALIWGKPPKLVGGKLLASGYWGIARHCNY
LGDILLALSFSLPCGTSSVIPYFYPTYLFILLIWRERRDEARCSEKYKEIWVEYCKLVPW
RIFPYVY
NT seq 1104 nt   +upstreamnt  +downstreamnt
atggagcacgtcgcggcggcgctggtgccctcctggagagcagtggtggtgctcttctcc
tacctagcctacctcgccgccgccggcgccatcctccccggcaagctcgtccccggagcc
gtcctcccggactcctctcgcctccactaccgctgcaatggtttgctctcgctcttcctc
ctgctggggctctcttcgctcggcgtctacatgggatggatgtcccctacggtcatagct
gaccgtggaatcgagctgctgtctgccaccttcatttttagtgttattgtcactttctta
ctgtattattcaggattaaggtcccatcataaaagttcttccttgaaaccgcatgtcagt
gggagcttcatacaagattggtggttgggagtgcagctcaatcctcatttcatgggagtt
gacctcaagttcttttttgtgagagctgggatgatggcatggttatttatcaacctatcg
ttgtttgcaaagagctacctagctggttcagccaatctttcagtcattctctaccaattc
ttttgtgtgtggtatattgtagattactttgttcatgaggaattcatgacctcaacatgg
gacattattgcggaaaggctgggcttcatgctggtttttggtgatctggtgttcattcca
tttaccttcaccattcagggatggtggcttttgagaaataaagtggagctgtcccatttg
gctgctatagtgaactgcaccatttttgttattggctatcttgtgttcagaggagccaac
aaacaaaaacacgtcttcaagaagaaccctaaagctcttatttggggcaaacctcccaaa
cttgttgggggaaagctacttgcatctggctactggggaatcgcaaggcactgtaattat
cttggggatatactgctagcactttcatttagcttaccttgtggaaccagttcggtgatc
ccatacttctatcctacatacctgttcatcttgctgatatggagggaaagaagagatgaa
gcaaggtgctcagagaagtacaaagagatctgggtagaatattgcaagcttgtgccttgg
aggatcttcccttatgtgtattaa

DBGET integrated database retrieval system