KEGG   Oryza brachyantha (malo sina): 102715564Help
Entry
102715564         CDS       T02995                                 

Definition
(RefSeq) beta-glucosidase BoGH3B-like
  KO
K05349  beta-glucosidase [EC:3.2.1.21]
Organism
obr  Oryza brachyantha (malo sina)
Pathway
obr00460  Cyanoamino acid metabolism
obr00500  Starch and sucrose metabolism
obr00940  Phenylpropanoid biosynthesis
obr01100  Metabolic pathways
obr01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:obr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    102715564
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    102715564
  09110 Biosynthesis of other secondary metabolites
   00940 Phenylpropanoid biosynthesis
    102715564
Enzymes [BR:obr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.21  beta-glucosidase
     102715564
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_3 Glyco_hydro_3_C
Motif
Other DBs
NCBI-GeneID: 102715564
NCBI-ProteinID: XP_015690731
Position
3
AA seq 625 aa AA seqDB search
MGSLHKFSFVILMLCYTTLASAQYVKYKDPKQPVSVRVKDLLSRMTLAEKIGQMTQIERE
NATAEQISKYFIGSVLSGGGSVPAPQASPQAWASMVDEMQKGALSTRLGIPIIYGIDAVH
GHNNVYKATIFPHNVGLGATRDPELVKKIGEATALEVRATGIPYVFAPCVAVCRDPRWGR
CYESYSEDPKVVQSFTTLISGLQGDVPSNDVGRPYVGGSKKVAACAKHYVGDGGTVKGIN
ENNTIIDTHGLMTIHMPPYYNSVIRGVSTVMVSYSSWNGVKMHANHHLITDFLKNKLRFR
GFVISDWQGIDRITSPPHKNYSYSIEAGIGAGIDMIMVPYTYTEFIDDLTEQVNNKIIPM
SRIDDAVYRILRVKFTMGLFESPFSDSSLANELGKQEHRELAREAVRKSLVLLKNGKSSY
SPVLPLPKKAGKILVAGSHADDLGRQCGGWTITWQGQPGNNITAGTTILSGIKATVDPST
TVVYSENPDSSVVAGDKYDYAIVVVGEPPYAEGFGDNLNLTIPEPGPSVIQTVCGSVKCV
VVLVSGRPLVVEPYIGGMDAFVAAWLPGTEGQGVADVLFGDYGFTGKLSRTWFRSADQLP
MNVGDAHYDPLFPFGYGLTTAAAHS
NT seq 1878 nt NT seq  +upstreamnt  +downstreamnt
atggggagtttgcacaagttcagttttgttatcctcatgctatgttacacaacgttggcg
agcgcgcagtatgtcaagtacaaggatccaaagcaacccgtctccgttcgtgtcaaggat
ctgctcagccggatgactctcgccgagaagatcggccagatgacccagatcgagagggag
aacgcgacggcggagcagatatccaagtacttcatagggagtgtgctgagtggtggaggg
agtgtgcctgctccccaggcatcacctcaggcctgggcttcaatggtggatgagatgcag
aagggcgctctttcgacgcggctaggtattccgatcatctatggtattgatgccgtgcat
ggtcacaataacgtctacaaggctaccatcttcccccataatgttgggcttggcgctacc
agggaccccgagctagtaaagaagataggagaagcaactgctcttgaagttagagctact
ggaattccctacgtctttgctccttgtgttgcggtttgcagagacccaagatggggacgc
tgctacgaaagctatagcgaagacccaaaggttgtccaatcatttaccaccctcatctcc
ggcttgcaaggcgatgttccatctaatgatgtaggaagaccatatgttggaggaagtaag
aaagttgctgcatgcgcgaagcactacgttggtgacggtgggacggtcaaggggatcaat
gagaacaacacaatcatcgacactcacgggctgatgaccattcatatgcctccttactat
aactctgtcatcagaggagtctccactgtcatggtttcgtactctagctggaatggagtg
aaaatgcatgcgaaccatcacctgatcaccgattttctcaagaacaagctccggttcagg
ggttttgtgatttcggactggcaaggcattgaccggatcacttctcctccacacaaaaac
tattcttactcaattgaggctggaattggtgctggcattgacatgatcatggttccttac
acctacacagaattcattgatgatctgacagagcaagttaacaacaaaattatccccatg
agcagaattgatgatgctgtctataggattctccgggtcaagttcaccatgggtctattt
gagagtcctttctctgattccagcctcgccaacgaactcggaaaacaggagcaccgtgaa
ctcgcgcgcgaagcagtcaggaagtccctggtgctgctgaagaacgggaaatcttcctac
tctccggtgctcccccttccgaagaaggccggaaagattctcgtcgcgggaagccatgcc
gacgacctgggaagacagtgtggaggatggaccatcacctggcaaggacagcccggcaac
aacatcactgctgggacgacgatcctgtcggggatcaaggccaccgtggatcccagcacg
acggtggtatactcggagaacccggacagcagcgtcgtcgccggcgacaagtacgactac
gcgatcgtggtggtcggcgagccgccgtacgcggaggggttcggcgacaacctgaacctg
acgatcccggagcccgggccgagcgtgatccagacggtgtgcgggagcgtcaagtgcgtg
gtggtgctcgtctccgggcggccgctggtggtggagccgtacatcggcggcatggacgcg
ttcgtggcggcgtggctcccgggcaccgaggggcagggcgtggccgacgtgctgttcggt
gactacgggttcaccggcaagctgtcgcggacgtggttcaggtccgcggaccagctgccg
atgaacgtcggcgacgcgcactacgacccgctcttccccttcggctacggcctcaccacg
gcggcggcgcacagctga

DBGET integrated database retrieval system