KEGG   Oryza brachyantha (malo sina): 102715592Help
Entry
102715592         CDS       T02995                                 

Definition
(RefSeq) external alternative NAD(P)H-ubiquinone oxidoreductase B1, mitochondrial
  KO
K17871  NADH:ubiquinone reductase (non-electrogenic) [EC:1.6.5.9]
Organism
obr  Oryza brachyantha (malo sina)
Brite
KEGG Orthology (KO) [BR:obr00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    102715592
Enzymes [BR:obr01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.5  With a quinone or similar compound as acceptor
    1.6.5.9  NADH:ubiquinone reductase (non-electrogenic)
     102715592
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox EF-hand_6 EF-hand_1 EF-hand_7 EF-hand_8 Pyr_redox_3 EF-hand_5
Motif
Other DBs
NCBI-GeneID: 102715592
NCBI-ProteinID: XP_015694284
UniProt: J3MGZ4
Position
6
AA seq 584 aa AA seqDB search
MGFFFASRAAARFLGEARISHPGVSTAALLLAAASGGGLVAYADSAAENASEQSQEAPKK
KKVVVLGTGWAGTSFLKDLDCSKYEVKVISPRNYFAFTPLLPSVTCGTVEARSIVEPIRK
MLEKKRKDVTFYEAECFKIDASKKAVHCRSAVGTNFDGNGDFMVDYDYLVVALGATVNTF
GTPGVMEHCYFLKEVEDAQKIRRNVIDCFEKASLPNISEEEKRRILHFVIIGGGPTGVEF
AAELHDFLVEDLVKIYPAIEDFVKITIIQSGEHILNMFDQRIATFAETKFQRDGIEVNTG
YRVIKVSDDLITMKSKSLGEVSVPYGMAVWSAGIGTRPVVMDFMHQIGQTNRRVLATNEW
LRVHECDGIYAIGDCASITQRKIMEDISTIFKMADKDNSGTLTLKEINDVLEDICIRYPQ
VELYMKSMHMLDTRDLIKDAIGDSHKEAMVVDIEEFKKALCKVDSQVKSVPATAQVAAQQ
GHYLAECFNKMDQCKEEPEGPLRMSGSGRHNFRPFRYKHLGQFVPLGGEQAAAELPGDWV
SMGHSTQWLWYSVYASKQVSWRTRMLVVSDWTRRFIFGRDSSRI
NT seq 1755 nt NT seq  +upstreamnt  +downstreamnt
atggggttcttcttcgcctcccgtgctgcggctcggttcttgggcgaggccaggatcagc
cacccgggcgtctccaccgctgcacttcttcttgcggcagcaagtggtggaggccttgtg
gcgtatgctgattctgctgcagagaatgcatcagagcaatctcaggaggctcccaagaag
aagaaagttgtggttcttgggactggctgggctgggacttctttcctcaaagatcttgac
tgctccaagtatgaagtgaaagtcatatcaccccgaaattactttgcatttacacctttg
cttccaagtgtgacatgtgggactgtagaagcacgcagcattgttgagccgatacgaaaa
atgcttgaaaagaaaaggaaagatgttacattctatgaagctgagtgtttcaagatcgat
gcgtcaaagaaagctgtccattgccgttctgctgttggaactaattttgatgggaatggc
gattttatggttgattatgattacctagtagttgctcttggggctacagtaaatacattt
ggcactcctggtgtgatggagcattgctactttttaaaggaggtagaggacgctcaaaag
atccggaggaatgtgatagactgctttgagaaagcttcacttcctaacattagtgaagag
gagaaaaggaggattcttcacttcgtgattattggtggcgggcccactggggttgaattt
gctgctgagctgcatgattttcttgtcgaggatctggtgaagatatatcctgcaattgaa
gattttgtgaagataacaattattcagtccggtgaacatatattgaatatgtttgaccaa
aggatagccacatttgctgaaacgaagttccagagagacggtattgaggtgaatacagga
tacagagtgataaaagtctctgatgatttgattacaatgaagagcaaatcacttggtgaa
gtatcggtaccatatggaatggctgtctggtctgcgggtattggtactcgtcctgttgtt
atggacttcatgcatcagatcggtcagaccaatcggcgagtcttggcaactaatgaatgg
ttaagagttcatgagtgtgatggtatctatgcaattggtgactgtgcttcaataactcaa
aggaaaataatggaggacatttcaacaatatttaaaatggctgataaggacaactctggc
actctaacactcaaagaaataaatgatgttcttgaagatatttgtataagatacccacaa
gtagaactgtatatgaaaagtatgcacatgcttgacactagggatttgataaaagatgcc
ataggtgattcccacaaggaagcaatggtggttgacatagaggagttcaaaaaagctcta
tgtaaagtggattcccaggttaaaagtgttccagcaacagctcaggttgccgcgcaacaa
gggcactatcttgctgaatgttttaacaagatggaccagtgcaaagaagagcctgaaggt
ccattgcgcatgtcaggatcaggacgacataatttccgcccattccgatacaaacatctt
gggcaattcgtgccattgggtggagagcaagctgctgcagagctcccgggcgactgggtt
tccatgggccatagcactcagtggctctggtactctgtatatgcaagcaaacaagtgagt
tggcgtacacggatgctggtggtgtctgactggactcgcaggttcatatttgggagggac
tcaagccgaatttag

DBGET integrated database retrieval system