KEGG   Oryza brachyantha (malo sina): 102716764Help
Entry
102716764         CDS       T02995                                 

Definition
(RefSeq) UDP-glucuronic acid decarboxylase 6
  KO
K08678  UDP-glucuronate decarboxylase [EC:4.1.1.35]
Organism
obr  Oryza brachyantha (malo sina)
Pathway
obr00520  Amino sugar and nucleotide sugar metabolism
obr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:obr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    102716764
Enzymes [BR:obr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.35  UDP-glucuronate decarboxylase
     102716764
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GDP_Man_Dehyd Epimerase Polysacc_synt_2 NAD_binding_4 3Beta_HSD RmlD_sub_bind NAD_binding_10 adh_short KR
Motif
Other DBs
NCBI-GeneID: 102716764
NCBI-ProteinID: XP_006649856
UniProt: J3LMI0
Position
3
AA seq 351 aa AA seqDB search
MAQKESNGSNSNGEHTTRPPPTPSPLRFSKFFQANLRILVTGGAGFIGSHLVDKLMENEK
HEVIVADNFFTGSKDNLKKWIGHPRFELIRHDVTQPLLVEVDQIYHLACPASPIFYKHNP
VKTIKTNVIGTLNMLGLAKRVGARILLTSTSEVYGDPLEHPQTEAYWGNVNPIGVRSCYD
EGKRVAETLMFDYHRQHGIEIRIARIFNTYGPRMNIDDGRVVSNFIAQAVRGEPLTVQKP
GTQTRSFCYVADMVNGLIKLMNGDNTGPINLGNPGEFTMLELAENVKELINPEVTVTMTE
NTPDDPRQRKPDITKAKEVLGWEPKIVLRDGLVLMEDDFRERLQVPKKNKA
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atggcgcagaaggagtccaatggcagcaacagcaacggcgagcacaccacccgcccgccg
ccgacgccctcgccgctccggttctccaagttcttccaggcgaacctgaggatcctcgtc
accggcggagctggcttcatcggctcgcacctcgtcgacaagctcatggagaacgagaag
cacgaggtcattgtcgctgacaacttcttcactggttcaaaagacaacctgaagaagtgg
attgggcacccaagatttgagcttatccgtcatgatgtcacccagcccctgcttgtggag
gttgaccaaatctatcaccttgcttgccctgcttcaccaatcttctacaagcacaaccca
gtcaaaaccatcaagacaaatgttattggaaccctgaacatgcttgggcttgccaagaga
gttggagctaggattttgttgacttcgacctctgaagtttatggtgatccgcttgagcac
cctcaaacagaggcctactggggaaatgttaacccaattggagttaggagctgctatgac
gagggtaagcgtgtcgcagaaacactgatgtttgactaccacaggcagcatggcattgag
atccgaattgccagaattttcaacacctatggacctaggatgaacattgatgatgggcgt
gttgttagtaacttcattgctcaggccgtacgtggcgagcccctgactgttcagaagcca
ggaacacaaactaggagcttctgctatgtcgccgacatggttaatggtcttattaagctg
atgaacggggacaacactgggccaattaatttgggaaacccaggtgaatttaccatgctg
gaacttgctgagaatgtgaaggagttgatcaacccagaggttactgttacaatgactgag
aacactcctgatgatcctcgccagaggaagccagacattacaaaggcaaaggaagttttg
gggtgggagcccaagatcgttctgcgtgatggcttggtgctcatggaagacgacttccgg
gagcgcctccaagtgcccaagaagaacaaggcctaa

DBGET integrated database retrieval system