KEGG   Oryza brachyantha (malo sina): 102720094Help
Entry
102720094         CDS       T02995                                 

Definition
(RefSeq) zinc-metallopeptidase, peroxisomal-like
  KO
K01408  insulysin [EC:3.4.24.56]
Organism
obr  Oryza brachyantha (malo sina)
Brite
KEGG Orthology (KO) [BR:obr00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:obr01002]
    102720094
Enzymes [BR:obr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.56  insulysin
     102720094
Peptidases and inhibitors [BR:obr01002]
 Metallo peptidases
  Family M16: pitrilysin family
   102720094
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M16_M Peptidase_M16 Peptidase_M16_C Octopine_DH
Motif
Other DBs
NCBI-GeneID: 102720094
NCBI-ProteinID: XP_006644800
UniProt: J3L4N4
Position
1
AA seq 975 aa AA seqDB search
MVAAAAAAAAGVEGNVEFIRARSDKREYRRVVLPNALECLLISDADTDKAAACMEVGVGS
FSDPEGLEGLAHFLEHMLFYASEKYPGEQDYTKYITEHGGSCNAFTSSETTNFYFDVNVA
NFEEALDRFAQFFIKPLMSEDAVLREIKAVDSEHKKNLLSDGWRMYQLQKHLASKDHPYH
KFSTGSWETLETKPKQRGLDIRQELLKFYENYSANLMHLVVYGKENLDCIQSCVDRLFSD
IKNTDQRSFKCPGRPLSEEHLQLIVKAIPISEGDYLKISWPVTPDLHFYKEGPCRYLSHL
IGHEGEGSIFHIIKELGWAMNLSAGEGSDSAEYSFFSISMRLTDAGHEHMEDIVGLVFKY
IILLKENGIHEWIFDELVAINETEFHYQDKVHPISYVTDTVSTMRLFPPEEWLVGASLPS
KYAPNRINMVLDELSAERVRILWKSKKFKGSTDSVEPWYSTAYSVENITPSTIKEWIQKA
PTEKLHIPKPNIFIPKDLSLKEMLEKVKFPVILRKTPLSQLWYKPDTLFSTPKVHIIIDF
HCPLSSHSPEAVVSTSLFVDLLEDYLNAYAYDARIAGLFYSIDRTSAGFQVSVGGYNDKM
RILLDAIMKHISNFEVKPNRFCALKETAVKDYKNFNFCQPYSQASYYLSLILEDQKWPLF
EKLEALSKLDSDTLAKFIPHLLSKTFLECYIHGNIEPNEATSIVQEIEDTIFNTPNSVFK
SMHPSQYLIKRVIMLENELKCYYQIEGLNQKNENSSVVQYIQVHLDDALSNIKLQLFSLI
ASQPAFNQLRTVEQLGYIAGLSLRSDCGVCALEVVIQSTVKDPSHLDARVDAFFKMFESK
IHELSDKDFKRNVESLIDSKLEKFKNLWEESHFYWGEIEAGTLKFDRVESEVALLRELRK
EEFIEFFDQYIRVGAPQRKTVSVQVFGGKHLAEFKAAIAEVDPPKTYRITDIFGFKRSRP
LYPSLKGGPGRITMD
NT seq 2928 nt NT seq  +upstreamnt  +downstreamnt
atggtggcggcggcggcggcggcagcggcgggtgtggagggcaatgtggagttcatccgc
gcgcgcagcgacaagcgggagtaccgccgggtggtgctccccaacgcgctggagtgcctc
ctcatcagcgacgccgacaccgacaaggcggcggcgtgcatggaggtcggcgtgggctcg
ttcagcgacccggaggggctcgagggcctcgcccacttcctcgagcatatgctattttat
gccagtgagaaataccctggtgaacaagattacacgaagtatatcacagagcatggtggc
tcttgcaatgcgtttacaagttcggagacaacaaatttctattttgatgtcaatgtggcc
aattttgaagaagcgttagatagatttgcacagttttttattaagcctttgatgtcggaa
gatgctgttcttagagagattaaggctgttgattctgaacacaagaaaaatttgttgtct
gatggatggagaatgtatcagctccaaaaacatctggcttcaaaggatcacccttatcat
aaattcagtactgggagttgggaaacgctagaaacaaaaccaaaacagaggggactggac
attagacaggagcttctgaagttttatgagaattattcagcaaaccttatgcaccttgtt
gtttatggaaaagagaaccttgattgcatccaaagctgtgttgatcgcttgtttagtgac
atcaaaaacactgatcagagaagcttcaaatgcccaggtcgacctctttcagaggaacat
ttgcagcttattgtcaaagcaatcccaatatccgaaggtgattatctaaagatatcatgg
ccagttacacctgacttacacttttacaaagaaggcccttgccgttatctcagtcatcta
attgggcatgaaggcgagggatccatcttccatattataaaggaactaggttgggctatg
aatttgtcggctggggagggcagtgacagtgctgagtactcctttttctcaattagcatg
aggctgactgatgctggtcatgaacacatggaagacatcgttggattggtcttcaaatat
attattttactaaaagaaaatggcatccatgagtggatctttgatgagcttgtggcgata
aatgaaacggaattccactatcaggacaaagtccatccaatcagctatgtgacagatact
gtctcaacgatgcggttattcccaccagaagaatggctggttggagcatcattgccgtcc
aagtatgctccaaatagaataaatatggtacttgatgagttgtcagctgaaagagtaagg
atactctggaaatctaaaaaatttaaaggatctactgattctgttgagccatggtatagt
acagcatattctgttgaaaatatcactccttctacgataaaggaatggattcaaaaagct
cctactgagaagctccatatcccaaagcctaatattttcattccaaaagatttatcactt
aaagaaatgcttgaaaaggttaaatttccagtaatactgagaaagacaccgctttcacag
ttgtggtataagcccgacacactgttctccactccaaaggttcacattataattgatttc
cactgtccattgtcaagccattcccctgaagcagttgtctcgactagtctatttgttgat
ctgttagaagattacttgaatgcatatgcctatgatgctcgaattgctggtttgttttat
tcaatagatcgcacgtctgctggattccaggtctcagtaggtggttacaatgacaagatg
cggattctgctagatgccattatgaagcatatatctaactttgaagttaaaccaaacagg
ttttgtgccttgaaggaaactgctgtcaaggattacaaaaatttcaacttctgccaacca
tactctcaagcttcatactatctatccttgatattggaggatcaaaaatggcctttattt
gagaaacttgaggctctttctaagcttgattcagatactcttgcaaagttcataccacat
ttgttatcgaagacatttttggaatgctatattcacgggaacatcgaaccaaatgaggct
acctctattgtacaggagattgaagatactatattcaatacccctaactcagtgttcaaa
tccatgcatccatcacaatatctgattaaaagggttatcatgcttgaaaatgagttaaag
tgctactaccaaattgaaggcttaaatcagaagaatgagaactcatcagtggttcaatat
attcaggtacatctggacgatgccctttcaaatatcaaacttcagctgttctctttaatt
gcaagccaacctgccttcaaccagctgcgaactgttgagcaacttggctatatagcagga
ctttcgctaagatctgattgtggagtctgcgcgctcgaggttgtcattcagtccacagta
aaggacccttcacatcttgatgctagagtcgatgcattcttcaagatgtttgaaagcaaa
atccatgaactatcagacaaggattttaagagaaatgtagaatcacttatcgattcgaaa
ctggagaaattcaaaaatctgtgggaggaatcccatttctattggggggagattgaggca
ggaactctcaagtttgatagggtcgaatccgaggtggctctcctaagagagctcaggaaa
gaagaattcatcgaattttttgatcagtatataagagttggtgcgcctcaaaggaaaaca
gtaagcgtgcaggtcttcggcggcaaacatttggcagagttcaaggcagccattgccgaa
gttgatccacccaaaacttaccgaatcacggatatattcggcttcaagcgatccaggcct
ctgtacccgtcattgaagggagggccaggtcggatcaccatggactga

DBGET integrated database retrieval system