KEGG   Oryza brachyantha (malo sina): 102720405Help
Entry
102720405         CDS       T02995                                 

Definition
(RefSeq) probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH5
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
obr  Oryza brachyantha (malo sina)
Pathway
obr03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:obr00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    102720405
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:obr03041]
    102720405
Enzymes [BR:obr01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     102720405
Spliceosome [BR:obr03041]
 Complex C
  Other components
   Step II factors
    102720405
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HA2 OB_NTP_bind Helicase_C S1 DEAD AAA_22 AAA_19 AAA_30 T2SSE AAA DUF2075 Sigma54_activ_2 Flavi_DEAD AAA_16 ABC_tran PhoH
Motif
Other DBs
NCBI-GeneID: 102720405
NCBI-ProteinID: XP_015688562
Position
2
AA seq 1221 aa AA seqDB search
AAGPSDDGLRKLEYLSLVSKVCSELETHIGVGDKVLAEFITELGRDSASVTDFDAKLKAN
GADLPDYFVRTLLTIIHAILPPPSDPRNPSSXXXXXXXXSKSPGLSRPDDPDRARTLRLE
LERDAEEAAAAAAPAPARDDRGRHRRDERGRDRDHDRRHDDRGRDYDRGRDCDHGRDRDR
DRDRARDGDRYRGRDNGRDRDQDRNRDDEWRRDRDKDRGGDFDRDRDRDHRRGRRYNDEE
EPEQFGGRKDGAVANSSGEPELYQVYRGRVTRVMDTGCFVRLEDVRGGREGLVHISQMAT
RRVANAKEMVKRDQEVYVKVVSVKGQKLSLSMRDVDQDTGRDLLPIQRGGDDAPRANPSG
GSASGVGGGSGKRLGLSGIMIAEEDEVAPISRRPLKRMSSPERWEAKQLIASGVLDVRDY
PMFDEDGDGMLYQEEGAEEEQEIELNEDEPAFLQGQSRFSIDMSPVKIFKNPEGSLSRAA
ALQTALIKERREVREQEQRAMLDSIPKDLNRPWEDPMPDTGERHLAQELRGVGLSAYDMP
EWKKEAYGKALTFGQRSKLSIQEQRQSLPIYKLKKELIQAVHDNQVLVVIGETGSGKTTQ
VTQYLAEAGYTTRGKIGCTQPRRVAAMSVAKRVAEEFGCRLGEEVGYAIRFEDCTGPDTV
IKYMTDGMLLREILVDENLSQYSVIMLDEAHERTIHTDVLFGLLKQLIKRRSDMRLIVTS
ATLDAEKFSGYFFNCNIFTIPGRTFPVEILYTKQPESDYLDAALITVLQIHLTEPEGDIL
LFLTGQEEIDHACQCLYERMKGLGKDVPELIILPVYSALPSEMQSKIFDPAPPGKRKVVV
ATNIAEASLTIDGIYYVVDPGFAKINVYNSKQGLDSLVITPISQASAKQRAGRAGRTGPG
KCYRLYTESAYRNEMSPTTIPEIQRINLGSTVLNMKAMGINDLLSFDFMDPPAPQALISA
MEQLYSLGALDEEGLLTKLGRKMAEFPLDPPLSKMLLASVDLGCSDEILTIIAMIQTGNI
FYRPREKQAQADQKRAKFFQPEGDHLTLLAVYEAWKAKNFSGPWCFENFVQSRSLRRAQD
VRKQLLTIMDRYKLDIVSAGRNFTKIRKAITAGFFFHAARKDPQEGYRTLVENQPVYIHP
SSALFQRQPDWVIYHELVMTTKEYMREVTVIDPKWLTELAPRFYKSADPTKMSKRKRQER
IEPLYDRYHEPNSWRLSKRRA
NT seq 3666 nt NT seq  +upstreamnt  +downstreamnt
gcggcggggcccagcgacgacgggctccgcaagctggagtacctctcgctggtctccaag
gtgtgctcggagctggagacgcacatcggcgtcggcgacaaggtgctcgccgagttcatc
accgagctcggccgcgactccgcctccgtcaccgacttcgacgccaagctcaaggccaac
ggcgccgacctcccggactacttcgtccgcacgctcctcactatcatccacgccatcctc
ccgccgccctccgacccgcgcaaccctagctcnnnnnnnnnnnnnnnnnnnnnnnnntct
aagtcccccggcctctcccgccccgacgaccccgaccgcgcccgcaccctccgcctcgag
ctcgagcgcgacgccgaagaggccgccgctgccgcagcccccgcacctgccagggacgac
cgtggccgccaccgccgtgacgagcgcggaagggaccgcgaccatgaccgccgccatgat
gaccgtggccgtgactatgaccgtggacgggattgtgaccatggccgtgacagagatagg
gatcgagaccgagcccgggatggggatcgatatcgtggccgtgataatggccgcgataga
gaccaagatagaaatcgagatgatgaatggcggagagaccgagataaggacagaggtgga
gattttgatagagatagagacagggaccataggcgaggcaggaggtacaatgatgaggaa
gaacccgagcagtttggtggaaggaaagatggtgctgttgctaattccagtggtgagcca
gagctttaccaggtgtaccggggtagggtgacacgggtaatggacaccggttgctttgtt
aggcttgaggatgttcgtggaggacgtgagggtcttgttcacatctcacaaatggccacc
agacgggtggccaatgcgaaagagatggtgaagcgtgatcaggaggtgtatgttaaggtg
gtttctgtgaagggccaaaagttgagtttgtcaatgagggacgtagatcaggatactggg
agagatctcctgccaatacaacgtggtggggatgatgcaccacgggcaaacccatctggt
ggtagtgctagtggtgttggtgggggctctggcaagaggctgggtctgtctgggattatg
attgcagaggaggatgaggttgcacctatatcacggcgaccacttaagaggatgagctct
ccggagaggtgggaagcaaagcagctgattgcttcaggtgtcctggatgtgagggattac
ccaatgtttgatgaggatggggatggtatgttataccaagaggaaggggcagaggaggag
caagagattgagcttaatgaggatgaacctgctttcttgcaggggcagagcagattttca
atcgacatgtcacctgttaagattttcaagaatccggagggttcattgagccgagctgct
gctctccaaactgctctcattaaggagcggcgtgaggttcgggaacaggaacagagagca
atgctggactcaatccccaaggatctgaataggccatgggaagacccaatgcctgataca
ggggagcggcaccttgcacaggaactgagaggtgttggactttcagcctacgatatgcct
gaatggaagaaggaggcatatggaaaggctttaacctttggacagaggtccaagctttca
atacaagagcagagacaaagtcttccaatatacaagttgaagaaagagctgatacaagct
gtgcacgataaccaagttttggtggttattggagagactggttctgggaaaaccacacag
gtgacgcaatatttggctgaagcaggctatacgaccaggggtaagattggttgcactcaa
cctcgtcgtgtggctgcaatgtctgttgctaagagagtagcagaagaatttggttgtcga
cttggagaggaagttggttatgccatccgctttgaggattgcactgggccagacacggtt
atcaaatacatgactgatggcatgcttctgcgtgagattctagtcgatgagaacctttcc
cagtattctgtaattatgcttgatgaagcgcatgaaaggaccatccacacagatgtcctc
tttggtttgctaaagcagcttattaagcgcagatctgacatgaggcttattgttacttct
gctaccctggatgcagagaagttctcagggtattttttcaattgcaacatcttcacaatt
cctggaagaacattcccggtagagatactctacaccaaacaaccagaaagtgactatttg
gatgcagcattgatcactgtgcttcaaattcacttgactgagccagaaggtgacatcctt
cttttcttgacgggtcaagaggagattgatcatgcctgtcaatgtctttatgagagaatg
aaagggcttggaaaagatgttccggagctcataattttgcctgtgtatagtgctcttccc
agtgagatgcagtcgaagatctttgatcctgctccaccagggaagaggaaggtggttgtt
gccaccaatatcgctgaagcctctctaaccattgacggtatatattatgttgtcgatcct
ggttttgccaaaattaatgtttataattcaaaacaagggcttgattcattggtcatcact
ccaatttctcaagcatcagcaaagcagagggccgggcgtgctgggcgtactggccctggc
aagtgttatcgtctatacactgaaagtgcataccgcaatgaaatgtctcccacaacaatc
ccagaaattcaaaggatcaacttggggtctacagttctcaacatgaaggcgatgggaatt
aatgacctattatcatttgatttcatggaccctccagcaccacaagcacttatatctgca
atggaacaattgtacagcctaggtgctcttgacgaggaagggctccttaccaaactgggg
aggaaaatggctgaatttccactagatccaccactttcaaagatgcttttagccagtgtt
gaccttggatgcagtgatgagatcctaactatcatagcaatgattcaaactgggaatata
ttctataggccaagagaaaaacaagctcaggctgatcaaaaaagggccaaattttttcag
ccagaaggggatcatctaactctgcttgctgtatatgaggcatggaaggcaaagaacttt
tcagggccctggtgttttgagaattttgttcaatcaagatccttaaggagagctcaagat
gtgaggaagcagcttctcactatcatggacagatataaactggacattgtttcagccggg
agaaacttcacaaaaataaggaaagcaatcactgctggttttttcttccacgctgccagg
aaggatccccaggagggatacagaaccttggttgagaaccagcctgtgtacatacaccca
agcagcgcattgttccagcggcagcctgactgggtcatctaccatgagcttgtgatgacg
acgaaggaatatatgcgggaggtaaccgtgatcgaccccaagtggctcaccgagctagcc
ccaaggttctacaagtcggcagatccaaccaagatgagcaagaggaagagacaggagagg
attgagcccctgtacgacaggtaccatgagcccaactcctggcgtctcagcaagcgccga
gcttga

DBGET integrated database retrieval system