KEGG   Oryza brachyantha (malo sina): 102721499Help
Entry
102721499         CDS       T02995                                 

Definition
(RefSeq) ribulose bisphosphate carboxylase small chain, chloroplastic-like
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
obr  Oryza brachyantha (malo sina)
Pathway
obr00630  Glyoxylate and dicarboxylate metabolism
obr00710  Carbon fixation in photosynthetic organisms
obr01100  Metabolic pathways
obr01110  Biosynthesis of secondary metabolites
obr01200  Carbon metabolism
Module
obr_M00165  Reductive pentose phosphate cycle (Calvin cycle)
obr_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
obr_M00532  Photorespiration
obr_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:obr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    102721499
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    102721499
Enzymes [BR:obr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     102721499
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RuBisCO_small RbcS
Motif
Other DBs
NCBI-GeneID: 102721499
NCBI-ProteinID: XP_006663955
UniProt: J3NCS3
Position
12
AA seq 170 aa AA seqDB search
MAPSVMASSATSVAPFQGLKSTAGMPVSRRSGSSSFGNVSNGGRIKCMQVWPIEGIKKFE
TLSYLPPLSVEDLLKQIEYLLRSKWVPCLEFSKVGFVYRENHRSPGYYDGRYWTMWKLPM
FGCSDATQVLKELEEAKKAYPDAFVRIIGFDNVRQVQCISFIAYKPPGSD
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atggccccctccgtcatggcctcgtcggccacatccgtcgctcccttccaggggctcaag
tccaccgccggcatgcccgtcagccgccgctccggcagctccagcttcggcaacgtcagc
aatggcggaaggatcaagtgcatgcaggtgtggccgatcgagggcatcaagaagttcgag
accctgtcgtacctgccgccgctgagcgtggaggacctcctgaagcagatcgagtacctg
ctgcggtccaagtgggtgccgtgcctcgagttcagcaaggtcggcttcgtctaccgcgag
aaccacaggtcccccgggtactacgacggcaggtactggaccatgtggaagctgcccatg
ttcgggtgcagcgacgccacccaggtgctcaaggagctcgaggaggccaagaaggcgtac
cctgacgccttcgtgcgcatcatcggcttcgacaacgtcaggcaggtgcagtgcatcagc
ttcatcgcctacaagcccccgggctccgactaa

DBGET integrated database retrieval system