KEGG   Oryza brachyantha (malo sina): 107305562Help
Entry
107305562         CDS       T02995                                 

Definition
(RefSeq) tyrosine decarboxylase 1-like
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
obr  Oryza brachyantha (malo sina)
Pathway
obr00350  Tyrosine metabolism
obr00360  Phenylalanine metabolism
obr00380  Tryptophan metabolism
obr00950  Isoquinoline alkaloid biosynthesis
obr00965  Betalain biosynthesis
obr01100  Metabolic pathways
obr01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:obr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    107305562
   00360 Phenylalanine metabolism
    107305562
   00380 Tryptophan metabolism
    107305562
  09110 Biosynthesis of other secondary metabolites
   00901 Indole alkaloid biosynthesis
    107305562
   00950 Isoquinoline alkaloid biosynthesis
    107305562
   00965 Betalain biosynthesis
    107305562
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:obr04147]
    107305562
Enzymes [BR:obr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     107305562
    4.1.1.105  L-tryptophan decarboxylase
     107305562
Exosome [BR:obr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   107305562
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-GeneID: 107305562
NCBI-ProteinID: XP_015699112
Position
Un
AA seq 115 aa AA seqDB search
GKALHLPGSLLFAGGGGGTILGTSCEAILCALVAARDRKLAEIGEDRISDLVVYCSDQTH
FAFRKAARVAGIRRDHCREIPTYRDDMFALSPAELHAAMQADVDAGLVPLFLCAT
NT seq 345 nt NT seq  +upstreamnt  +downstreamnt
ggcaaggcgctccacttgccggggagccttctgttcgccggaggaggcggcggcacgatc
cttggcacgtcgtgcgaggccatcctttgcgcgctcgtcgccgcgagggaccgcaagctc
gcggagatcggcgaggacaggatcagcgatctcgtcgtctactgctccgaccagacccac
ttcgccttccgcaaggcggcgcgcgtcgccggcatccggcgggaccactgccgcgagata
ccgacgtaccgcgacgacatgttcgccctctcgccggcggagctgcacgccgccatgcag
gccgacgtggacgccggcctggtccccctgttcctgtgcgccacg

DBGET integrated database retrieval system