KEGG   Opitutaceae bacterium TAV5: OPIT5_08465Help
Entry
OPIT5_08465       CDS       T03683                                 

Definition
(GenBank) glucose-6-phosphate 1-dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
obt  Opitutaceae bacterium TAV5
Pathway
obt00030  Pentose phosphate pathway
obt00480  Glutathione metabolism
obt01100  Metabolic pathways
obt01110  Biosynthesis of secondary metabolites
obt01120  Microbial metabolism in diverse environments
obt01130  Biosynthesis of antibiotics
obt01200  Carbon metabolism
Module
obt_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
obt_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:obt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    OPIT5_08465
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    OPIT5_08465
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:obt04147]
    OPIT5_08465
Enzymes [BR:obt01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     OPIT5_08465
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     OPIT5_08465
Exosome [BR:obt04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   OPIT5_08465
  Exosomal proteins of colorectal cancer cells
   OPIT5_08465
  Exosomal proteins of bladder cancer cells
   OPIT5_08465
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-ProteinID: AHF90229
UniProt: W0J0K6
Position
complement(1863894..1865441)
Genome map
AA seq 515 aa AA seqDB search
MSAADAHRHPFLQGLSKHRGAPPTVIVIFGASGDLTARKLIPAIYNLGFDNLLPADFHLV
GYGRKPIPDDEFRKIATDAVKEFSRRELNADVWDRVASRTTYVAGGYDDPEAFKRLAAHI
TGLEKKHGRELQTLFYISTPPSVFEPILENLGASGLASKYLGQPHHAKVIIEKPFGRDLA
SALELNGTIRRVFEEHQVYRIDHYLGKETVQDMLVQRFSNAIFEPLWNRNYINSVQITVA
EEVGVGTRGGYYEQSGCLRDMIQNHTMQLVALTAMEPPVSLAAEAVRDEKVKLLKAIQPL
RLGSGPESDVARAQYAAGMTGGKQVKGYLEEEGISEKSATETYAAIRLSINNWRWQGVPF
YLRSGKRMARRVTEIAIEFKRPPGTLFAGGGFDLAPNTLSFQIQPDEGLNLILNGKVPGL
ETRTQPVKMNFRYSATFGSNTPEAYERLVLDAMIGDGTLFIRGDEAETSWKLYTPLLEAW
AAAGREGIDTYAAGSWGPAAADALLAREGHTWRKP
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atgtctgccgccgacgctcaccgccatccgttcctgcaaggtctcagcaagcaccggggc
gctccgcccaccgtcatcgtcatttttggcgcatccggcgacctcaccgcccgcaagctc
atccccgccatctacaacctcggcttcgacaacctcctccccgccgatttccatctcgtc
ggctacggacgcaagcccatccccgacgacgaattccggaagatcgccaccgacgccgtg
aaagagttttcccgccgcgagctcaatgccgacgtctgggaccgcgtcgcctcccgcacc
acctacgtcgccggcggctacgatgatcccgaagccttcaaacgcctcgccgcccacatc
accggactcgaaaagaagcacggccgcgaactgcaaacgcttttctacatctccacgccg
ccttccgtattcgaacccatcctggaaaacctcggcgcctccggtctcgcctcgaaatac
ctcggccagccgcatcacgccaaggtcatcatcgaaaaacccttcggcagggacctcgcc
tccgccctcgaactcaacggcaccatccgccgtgtcttcgaggagcaccaggtgtatcgg
atcgatcactacctcggcaaggagaccgtgcaggacatgctcgtgcagcgtttctccaac
gccatctttgaaccgctctggaaccgcaactacatcaactccgtgcagatcaccgtggcc
gaggaagtcggcgtgggcacgcgcggcggttattacgagcagagcggctgcctgcgcgac
atgatccagaaccacaccatgcagctcgtcgcgctcaccgcgatggagccgcctgtgtcg
ctcgccgccgaagccgtccgtgacgagaaggtcaagctcctgaaagccatccagcctctc
cggctcggctccggacccgaatccgacgtggcccgcgcccagtacgccgccggcatgacg
ggcggcaagcaggtgaaaggttatctggaagaggagggcatctccgaaaaatccgcgacc
gagacctacgcggcgatccgcctctcgatcaacaactggcgctggcagggcgtgccgttt
tacctgcgctccggcaaacgcatggcgcgccgcgtcaccgaaatcgccatcgagttcaag
cgcccgcccggcacgctctttgccggcggcggtttcgacctcgctcccaacacgctctcg
ttccagatccagcccgacgaagggctcaacctcatcctcaacggcaaggtgcctggcctc
gaaacccgcacccagccggtgaagatgaacttccgctacagcgccaccttcggttccaac
acgcccgaagcctacgagcgcctcgtgctcgatgcgatgatcggcgacggcacgctcttc
atccgtggcgacgaggccgagacctcctggaaactctacacgcccctcctcgaagcctgg
gccgccgccggccgcgagggcatcgacacctacgccgccggctcctggggcccggccgcc
gccgacgccctcctcgcccgcgaaggccacacctggagaaaaccgtga

DBGET integrated database retrieval system