KEGG   Oligotropha carboxidovorans OM5 (Mississippi): OCAR_4294Help
Entry
OCAR_4294         CDS       T00783                                 

Gene name
argG
Definition
(GenBank) argininosuccinate synthase
  KO
K01940  argininosuccinate synthase [EC:6.3.4.5]
Organism
oca  Oligotropha carboxidovorans OM5 (Mississippi)
Pathway
oca00220  Arginine biosynthesis
oca00250  Alanine, aspartate and glutamate metabolism
oca01100  Metabolic pathways
oca01110  Biosynthesis of secondary metabolites
oca01130  Biosynthesis of antibiotics
oca01230  Biosynthesis of amino acids
Module
oca_M00844  Arginine biosynthesis, ornithine => arginine
Brite
KEGG Orthology (KO) [BR:oca00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    OCAR_4294 (argG)
   00220 Arginine biosynthesis
    OCAR_4294 (argG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:oca04147]
    OCAR_4294 (argG)
Enzymes [BR:oca01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.5  argininosuccinate synthase
     OCAR_4294 (argG)
Exosome [BR:oca04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   OCAR_4294 (argG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginosuc_synth QueC tRNA_Me_trans
Motif
Other DBs
NCBI-ProteinID: ACI91443
UniProt: B6JAT0
Position
complement(284706..286043)
Genome map
AA seq 445 aa AA seqDB search
MSTILKSLPKGENVGIAFSGGLDTSAALLWMKQKGARVFAYTANLGQPDEADYDEIPRKA
LEFGAEKARLVDCRTQLVHEGIAAIQSGAFHVSTGGIAYFNTTPLGRAVTGTMLVSAMKE
DGVNIWGDGSTYKGNDIERFYRYGLLTNPELRIYKPWLDQQFIDELGGRAEMSAFMTAHG
FAYKMSAEKAYSTDSNILGATHEAKDLEHLDSGIKIVNPIMGVPFWRDDCAVKAEKVSVR
FEEGQPVALNGQTFTDPVALFLEANTIGGRHGLGMSDQIENRIIEAKSRGIYEAPAMALL
HIAYERLVTGIHNEDTIEQYRISGMRLGRLLYQGRWFDSQALMLRETAQRWVARAITGEV
TLELRRGNDYSILNTESPNLTYAPERLSMEKVEDAAFTPGDRIGQLTMRNLDISDTRRKL
NLYTQTGLLSAEQGSHIPRLDNDKS
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atgagtacgattctgaagagccttcccaaaggagaaaatgtcggcatcgctttctcgggc
gggcttgataccagcgcggcactgctgtggatgaagcagaagggcgcgcgcgtcttcgcc
tataccgccaatctcggccaacccgacgaagccgactacgacgagattccacgtaaagcg
ctcgaattcggcgccgagaaggcgcgcctcgtggattgccgcacgcaactggttcacgaa
ggcatcgccgcgattcaatcgggtgccttccacgtctcgaccggcggcatcgcctacttc
aacaccacgccgctcggccgtgccgtgactggcacgatgctggtctcggcgatgaaggaa
gacggcgtcaacatctggggcgacggctcgacctacaaaggcaacgacatcgagcggttc
tatcgctacgggctgctgaccaatccggagctgcggatctacaagccctggcttgaccag
cagttcatcgacgaactgggcggccgcgcggaaatgtcggcgttcatgaccgcccacggt
tttgcttacaagatgagcgccgagaaggcgtattcgaccgacagcaatatcctcggcgcc
acgcatgaggccaaggatctcgaacacctcgacagcggcatcaagatcgtcaacccgatc
atgggtgtgccgttctggcgcgacgattgcgccgtgaaggccgaaaaggtttcggtgcgt
ttcgaggaaggtcagcccgttgcgctgaacggccagaccttcaccgatccggtcgcgctg
ttcctcgaggccaataccatcggcggccggcacggccttggcatgagcgaccagatcgag
aaccgcatcatcgaggcgaagagccgcggcatctatgaggcgccggccatggcgctgctt
cacatcgcctatgaacgtctcgtcaccggcatccacaacgaagacaccatcgagcaatac
cggatcagcggcatgcgtctcggccgtttgctctatcaggggcgctggttcgattcccaa
gccttgatgctgcgcgaaacggcgcagcgttgggtggcgcgcgcgatcaccggcgaggtg
acgttagagctgcgccgcggcaatgactactcgatcctcaacaccgagagcccgaatctg
acttatgcgccggagcggctcagcatggagaaggttgaggatgcagcgttcacgccgggc
gatcgcatcggccagttgaccatgcgcaacctcgatatttccgatacgcgccgcaagctc
aatctctacacgcagacgggcctgctgtcggccgagcagggctctcacattccccggctc
gataacgacaagagctga

DBGET integrated database retrieval system