KEGG   Oligotropha carboxidovorans OM5 (Mississippi): OCAR_4583Help
Entry
OCAR_4583         CDS       T00783                                 

Gene name
sucB
Definition
(GenBank) dihydrolipoyllysine-residue succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
oca  Oligotropha carboxidovorans OM5 (Mississippi)
Pathway
oca00020  Citrate cycle (TCA cycle)
oca00310  Lysine degradation
oca01100  Metabolic pathways
oca01110  Biosynthesis of secondary metabolites
oca01120  Microbial metabolism in diverse environments
oca01130  Biosynthesis of antibiotics
oca01200  Carbon metabolism
Module
oca_M00009  Citrate cycle (TCA cycle, Krebs cycle)
oca_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:oca00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    OCAR_4583 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    OCAR_4583 (sucB)
Enzymes [BR:oca01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     OCAR_4583 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 HDPD PRCC
Motif
Other DBs
NCBI-ProteinID: ACI91727
UniProt: B6JCZ7
Position
576486..577727
Genome map
AA seq 413 aa AA seqDB search
MAEIRVPTLGESVTEATIGRWFKKTGDAVAVDEPLVELETDKVTIEVPSPSAGTLGEIVV
KDGETVAVGALLGQITEGAAKPAAAKPAEAAPAKPAAAAAAAAPAPSQKSPPADAPQAPS
VRKLSAESGIDAGTVAGSGKDGRVTKGDMLAAIEKAAASPTPINQPAASLQVRAPSPPDD
AAREERVRMTRLRQTIARRLKDVQNTAAMLTTFNEVDMSNVMALRGQYKEMFEKKHHAKL
GFMGFFVKACVQALKEIPAVNAEIDGTDIVYKNYYHVGVAVGTDKGLVVPVVRDCDRKSI
AEIETTIADLGKRARDGQLKIDEMQGGTFTLTNGGIYGSLMSTPILNAPQSAILGMHKIQ
ERPVAIGGKVEVRPMMYLALSYDHRVIDGKEAVTFLVRVKENLEDPARLVLDL
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atggctgaaatccgcgttccgacactcggcgagtccgtcaccgaggccaccattggccgc
tggttcaagaagaccggcgacgccgttgccgtcgacgagccgctcgtcgaactggagacg
gacaaggtgacgatcgaggtgccctcgccatccgccggcacgctcggcgaaatcgtcgtc
aaggatggcgagacggtcgccgttggcgcgctgctcggccagatcaccgaaggtgcggcc
aagcctgccgcggcgaagcccgcagaggcggcgccggcgaagcctgctgcggctgcggcc
gccgctgctccggctccctcacaaaaatcgccgccggctgatgcgccgcaggcgccctcc
gtacgcaagctgtcagccgagagcggcatcgatgccgggactgttgccggcagcggcaag
gatggccgcgtcaccaagggcgacatgctagccgcaatcgagaaggcagcggcctccccg
acgccgatcaaccagcctgccgcctcgctgcaggtgcgcgcgccttcgccgccggatgat
gccgcgcgcgaggagcgggtgcggatgacgcgactgcgccagaccatcgcccgccgcctc
aaggacgtgcagaacaccgccgcgatgctgacgaccttcaacgaggtcgacatgtcgaac
gtcatggccctgcgtggccaatacaaggagatgttcgagaagaagcaccacgcgaagctt
ggcttcatgggcttcttcgtgaaggcttgcgtgcaggcgctgaaggaaattccggcagtg
aacgccgagatcgacggcaccgatatcgtctacaagaactattatcatgtcggcgtcgcc
gtcggcaccgacaagggcctcgtggtgccggtggtgcgcgattgcgatcgcaaatcgatc
gccgagatcgaaaccaccattgccgatctgggcaagcgcgcgcgcgacggtcaactcaag
atcgacgagatgcagggcggcaccttcaccctgaccaatggcggcatttatggctcgctg
atgtcgactccgatcctcaacgcgccgcagtccgccattctcggcatgcacaagattcag
gagcgcccggtcgcgatcggcggcaaggtcgaggtgcggccgatgatgtatctcgcactg
tcctacgatcaccgcgtcatcgacggcaaggaagcggtgaccttcctcgtccgcgtcaag
gagaacctcgaggacccggcgcggctcgtgctcgacctgtaa

DBGET integrated database retrieval system