KEGG   Afipia carboxidovorans OM5 (Mississippi): OCAR_6422
Entry
OCAR_6422         CDS       T00783                                 
Name
(GenBank) conjugal transfer protein TrbI
  KO
K20533  type IV secretion system protein TrbI
Organism
oca  Afipia carboxidovorans OM5 (Mississippi)
Pathway
oca02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:oca00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    OCAR_6422
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:oca02044]
    OCAR_6422
Secretion system [BR:oca02044]
 Type IV secretion system
  Trb secretion system protein
   OCAR_6422
SSDB
Motif
Pfam: TrbI
Other DBs
NCBI-ProteinID: ACI93535
Position
complement(2362335..2363543)
AA seq 402 aa
MTDLPNPPPGDIRAELRLRPEQPRVTRLSRKVLITLGSVSAVAIMAALFWALDANRRANQ
SPTELYSTENRTPADGLAGLPKDYTGIPKLGPALPGDLGRPIVSAQDEGKPVVAPDIRTP
RADPTEQRRLAEIEAARVAKVFTDSRGVQATVASAPAIGRVDPAAGLTLPAETPPLDPGA
AQNMQDRKLAFVNAAVDRRTVTPDRVQEKASPYVVQAGTVIPAALITGIKSNLPGTITAQ
VTEQVYDTPTGKQLLIPQGARLIGQYDSQVAFGQSRVLLVWNRIIMPNGTSIVLERQPGA
DAEGYSGLEDDVDYHWGQLFKAALLSTLLSVGSEAGYSGNESDIARALRQGTSNSTSQIG
RQIVGRQLNIQPTLTIRPGFPVRVIVNRDLILQPYGAAKEPS
NT seq 1209 nt   +upstreamnt  +downstreamnt
atgaccgacctacctaatccgcctcccggcgatatccgtgccgagctgcgcttgcggccc
gaacagccgcgcgtcacgcgcctgtcgcgcaaggtgctcatcacgctcggcagcgtcagc
gccgtcgccatcatggccgcgctgttctgggcgctcgatgccaaccgccgcgccaaccaa
tcgccgaccgaactctacagcaccgagaaccgcacgccggcggacggactcgccggcttg
ccgaaggactacaccggcattcccaagctcggcccggcgctgccgggcgacctggggcgt
ccgatcgtgagtgcgcaggatgaaggcaaacccgtcgtcgcgccggatatccgcacgccg
cgcgccgatccgaccgaacaacgtcgtctcgccgagatcgaagccgcacgcgtcgccaag
gtcttcaccgacagccgcggcgtgcaggcgacggtcgcatctgcgcccgcgattggccgc
gtcgatccggcggcgggtctcacgctgccggccgaaacgccgccgctcgatccgggtgcg
gcgcagaacatgcaggaccgcaagctcgccttcgtcaatgccgccgtcgatcggcgcacc
gtcacgcctgatcgcgtgcaggagaaggcgtcgccctatgtcgtgcaggccggcaccgtc
atccccgctgcgctgattaccggcatcaaatccaatctgcccggtacgatcaccgcgcag
gtgacggagcaggtttacgatacaccgaccggcaagcagcttctcatcccacaaggcgca
cggctgatcggtcagtacgacagtcaggtcgcgttcgggcagtcgcgcgtgctgctggtc
tggaatcgcatcatcatgccgaacggcacgtcgatcgtgttggagcggcagcccggtgcc
gacgccgaaggttattccgggctcgaggacgacgtcgactatcattggggtcagctcttc
aaggcggcgttgttgtcgacgctgctcagcgtcggctcggaggcaggctattcgggcaat
gagagcgatattgcccgagcgttacggcaaggcacgtcgaacagcaccagccagatcggt
cggcaaatcgtcggccgtcagctcaacattcagccgacgctcactatacggccgggattc
cccgtccgcgtgatcgtcaatcgtgacctcatattgcagccctatggagcggcgaaggag
ccgtcatga

DBGET integrated database retrieval system