KEGG   Afipia carboxidovorans OM5 (Mississippi): OCAR_6423
Entry
OCAR_6423         CDS       T00783                                 
Name
(GenBank) conjugal transfer protein TrbG/VirB9/CagX
  KO
K20532  type IV secretion system protein TrbG
Organism
oca  Afipia carboxidovorans OM5 (Mississippi)
Pathway
oca02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:oca00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    OCAR_6423
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:oca02044]
    OCAR_6423
Secretion system [BR:oca02044]
 Type IV secretion system
  Trb secretion system protein
   OCAR_6423
SSDB
Motif
Pfam: CagX
Other DBs
NCBI-ProteinID: ACI93536
Position
complement(2363543..2364583)
AA seq 346 aa
MGNNMKNAARRSLRRLSVLVAIILATTALAGCANKFIPPDINYDDAAPAVLSADPVGPVK
VVELPKPLPLPGQLKPVNAGKTKPEPADPKKRVAQANEAARMQPVRNGFINAVQVYPFVV
GALYQVYAAPGQVTDIALQPGEQLVGAGPVAAGDTVRWIVGDTLSGSGRAAQVHILVKPT
RPDLQTNLVINTNLRTYHMELRSTEKTYMASVSWQYPQDQLIALRRRNQQAALMQPVASG
VDISKLNFRYQIEGDDAPWRPLRAFDDGNKIYIEFPSGIGQGEMPPLFVIGPSGNSELVN
YRARQNYYVVDRLFAAAELRLGDKDSEKRVRIVRTDGRPGRGLRLF
NT seq 1041 nt   +upstreamnt  +downstreamnt
atggggaacaatatgaagaatgccgcgcgcagaagcttgcgtcggttgtcagtgctggtc
gccataatcctagcgacgacggcgctcgccggctgcgccaacaagttcattccgccggac
atcaattacgacgatgccgcgcccgctgtgctcagcgccgatcccgtcggtccggtgaag
gtggtcgagctgccgaagccgttgccgctgccgggccagttgaagcccgtcaatgcggga
aagacgaaacccgaaccggccgatccgaagaagcgcgtggcgcaagcgaacgaagcggca
cggatgcagcccgtgcgcaacggcttcatcaatgccgtgcaggtctatccgttcgtcgtc
ggcgcactctatcaggtctatgccgcgcccggacaagtaaccgacatcgcgcttcagccc
ggcgagcagcttgtgggagccgggccggtcgccgcgggcgacaccgtgcgctggatcgtc
ggcgacacgctcagcggctccggtcgcgccgcgcaggtccacatcctggtcaagccgacg
cggcccgatcttcaaaccaacctcgtcatcaacactaacctgcgcacctaccacatggag
ctgcgatcgaccgagaagacttacatggcttcggtatcgtggcagtatccgcaggaccag
ttgatcgcgctgcgccggcggaaccaacaggctgcgctcatgcagccggtcgcgtccggc
gtcgatatctcgaaactaaacttccgctatcagatcgaaggcgacgacgcgccgtggcgg
ccgctgcgcgccttcgacgacggcaacaaaatctatatcgagtttccgtccgggatcggc
cagggcgagatgccgccgctgttcgtcatcggaccgtctggcaattccgaattggtcaac
taccgcgcccgccagaactattacgtcgtcgatcgtctgttcgccgcggccgaactgcgc
ctgggcgacaaggacagcgagaagcgcgtgcgcatcgtgcgcaccgacggccggccgggg
cgtggcctgaggttgttctga

DBGET integrated database retrieval system