KEGG   Afipia carboxidovorans OM5 (Mississippi): OCAR_6424
Entry
OCAR_6424         CDS       T00783                                 
Name
(GenBank) conjugal transfer protein
  KO
K20531  type IV secretion system protein TrbF
Organism
oca  Afipia carboxidovorans OM5 (Mississippi)
Pathway
oca02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:oca00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    OCAR_6424
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:oca02044]
    OCAR_6424
Secretion system [BR:oca02044]
 Type IV secretion system
  Trb secretion system protein
   OCAR_6424
SSDB
Motif
Pfam: VirB8 Sensor
Other DBs
NCBI-ProteinID: ACI93537
Position
complement(2364583..2365269)
AA seq 228 aa
MNLFRRPSVRYARTPEPETPYLKAAQVWDERIGSARVQAKNWRMMAFGSLALAGGFAAAL
VWQSTLGTVVPWVVQVDKFGEAQVVASAIADYKPTDPQIAWHLARFIEQVRSIPADPVIV
RQNWLRAYDYTTDRGAIALNDYARGNDPFAKVGKQQVAVEISSVIRASPESFRIAWLERR
YENGQLSGTERWTAILSVVIQQPRTADKLRANPLGVFVNAINWSKEMG
NT seq 687 nt   +upstreamnt  +downstreamnt
atgaatctcttccgccgaccttccgtccgctatgcgcgcacgcccgaacccgaaactccc
tatctcaaagccgcgcaggtgtgggatgagcgcatcggcagcgcgcgcgttcaggccaag
aattggcgtatgatggccttcggctcactggcgctcgccggcggcttcgcggccgcgctc
gtgtggcagtcgacgctgggcaccgtcgttccctgggtggtgcaggtcgacaagttcggc
gaggcgcaggttgtggcctccgccatcgcggactacaagccgaccgatccgcagatcgcg
tggcatctcgcgcgcttcatcgagcaggtgcgcagcattcccgccgatcccgtcatcgtg
cgacaaaactggctacgcgcctacgactacacgaccgatcgcggcgccatcgcgctcaac
gattacgcgcgcggcaacgatcccttcgcgaaggtcggtaagcagcaggtcgcggtcgag
atttccagcgtcatccgcgcatcacctgagagcttccggatcgcctggctagagcgccgc
tacgagaacggccagctctccggcacggaacgctggaccgccatcctgagcgtcgtgatc
cagcagccgcgcaccgccgacaagctgcgcgctaatccgctcggtgtgttcgtcaacgca
atcaactggtcgaaggagatggggtga

DBGET integrated database retrieval system