KEGG   Afipia carboxidovorans OM5 (Mississippi): OCAR_6425
Entry
OCAR_6425         CDS       T00783                                 
Symbol
trbL2
Name
(GenBank) conjugal transfer protein TrbL
  KO
K07344  type IV secretion system protein TrbL
Organism
oca  Afipia carboxidovorans OM5 (Mississippi)
Pathway
oca02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:oca00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    OCAR_6425 (trbL2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:oca02044]
    OCAR_6425 (trbL2)
Secretion system [BR:oca02044]
 Type IV secretion system
  Trb secretion system protein
   OCAR_6425 (trbL2)
SSDB
Motif
Pfam: TrbL Glyco_transf_7C
Other DBs
NCBI-ProteinID: ACI93538
Position
complement(2365266..2366672)
AA seq 468 aa
MNTGVIDRFLETFTRYIDSGFGLLGGEIGFLTSTLIVIDITLAGLFWAWGADEDVLARLV
KKTLYIGFFAFIIGNFNKLAGIVFQSFSGLGLKAGGSSMTADTLLQPGRVAQVGIDAGTP
ILKAAGDLMGYISFFENFVQIMVLMIAWAIVLIAFFILAVQIFVTLIEFKLTTLAGFVLI
PFALFNKTAFLAEKVLGNIVASGIKILVLAVIVGIGSGLFSEFTTGFSGTPTITDALALV
LGALSLMGLSIFGPGIATGLVSGAPQLGAGAAVGTGLAAAGIGAAGVMGATAGISGAASA
IGTGGRLSAASARGGAYLAGGVAQSYGQSASASGASGMRKAAAGVGGVAKAGAGAAVQPV
RQAVSRATQSLRSGADSLRSSYAAGRAAASNAAGGQASAGSAVAAGNTSTGGATGAGAAA
SSAPPNWAARMKRSQTMSHGATAAAHAVRSGDHGGGSMSVSLDQDDRK
NT seq 1407 nt   +upstreamnt  +downstreamnt
atgaacaccggcgtcatcgaccgctttctggagaccttcacccgctacatcgattcaggc
ttcggtctgctcggcggcgagatcggattcctcacctccacgctgatcgtcatcgacatc
acgctggccggcctattctgggcgtggggcgctgatgaagacgtacttgcgcgtctcgtc
aagaagacactttatatcggcttcttcgccttcatcatcggcaacttcaacaagctcgcc
ggcatcgtcttccagtccttcagcggcctcggcctgaaggccggcggatcgtcgatgacg
gccgacacgctgcttcaacccggccgtgtcgcgcaggtcggcatcgacgccggcactccc
atcctcaaggccgctggcgacctgatgggctacatctccttcttcgagaacttcgtgcag
atcatggtgctgatgatcgcctgggcgatcgtgctcatcgcctttttcatcctcgccgtc
cagatcttcgtcacgttgatcgagttcaagctcacgaccttagccgggttcgtcctgatc
cccttcgcgctgttcaacaagaccgcgttcctcgccgaaaaggtgcttggcaacatcgtt
gcctccggcatcaagatattggtgctcgccgtcatcgtcggcatcggctccggcctgttc
agtgagttcacgaccggattctccggcacgccgaccatcaccgacgcgctggcactcgtg
ctcggtgcgctgtcgctgatgggcctgtcgatcttcggtcccggtatcgccaccgggctc
gtctccggcgcaccgcaactcggtgcgggagccgccgttggcaccggccttgccgccgcc
ggcatcggcgcggctggcgtgatgggagcgacagcgggcatttccggcgcggcgagcgcg
atcggaaccggcggccgcttgtcggcggcaagcgcacgcggcggcgcatacctcgcgggc
ggcgtcgcccaatcctacgggcagtcggcttcggcctctggcgcatccggtatgaggaag
gcggctgccggcgtcggtggcgtggccaaggctggcgctggagcggctgttcaaccggtc
cggcaggcggtgtcgcgcgccacccaatcccttcggtcgggggcggattcccttcggtcg
agttatgcggcgggccgggccgccgcatcgaacgctgccggtggacaggcatctgcgggg
tcggcggtcgctgcgggcaatacctcaacgggcggggcgacaggtgcgggagcagcggct
tcgtcggcgccgcccaactgggccgcgcgcatgaaacgcagccagaccatgagccacggc
gcgaccgccgccgcccatgccgtgcgctctggcgatcacggcggcggctccatgtccgtt
tctctcgaccaggatgaccgcaaatga

DBGET integrated database retrieval system