KEGG   Afipia carboxidovorans OM5 (Mississippi): OCAR_6426
Entry
OCAR_6426         CDS       T00783                                 
Symbol
trbJ2
Name
(GenBank) P-type conjugative transfer protein TrbJ
  KO
K20266  type IV secretion system protein TrbJ
Organism
oca  Afipia carboxidovorans OM5 (Mississippi)
Pathway
oca02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:oca00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    OCAR_6426 (trbJ2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:oca02044]
    OCAR_6426 (trbJ2)
Secretion system [BR:oca02044]
 Type IV secretion system
  Trb secretion system protein
   OCAR_6426 (trbJ2)
SSDB
Motif
Pfam: Effector_1 DUF4141 DUF948 DUF5065 PhoD_2 DUF5407 DUF5929 Sec34 Syntaxin_2
Other DBs
NCBI-ProteinID: ACI93539
Position
complement(2366946..2367698)
AA seq 250 aa
MILSVSRLSYPRSIAAGALALVVALAPGGAVAFDIVYDPSNYAQNVLTAARALQQINNQV
TSLANQTQMLINQAKQLTKLPTSVLSQIEGNFAEMKRLMGEADKLAYNVSNIEAQFSPTF
QNFAAGKSDAQLAALARDRWQQSLSAYEHSLKAGAVAVQNLEGTRSQTSTLLDTSQSAVG
LLQATQAGNQLLGVQARQVADLTAMLAAQGRADALENSRKAAAQEQSREQFSRFMIGSSY
SPTPVRMFHD
NT seq 753 nt   +upstreamnt  +downstreamnt
atgattctgtccgtatcccgcctgagttatccccgctcgatcgctgcgggagcgctcgcg
cttgtcgtggcgctcgcgcccggcggcgcggtcgcattcgacatcgtctacgacccgagt
aactacgcgcagaacgttctgactgccgcgcgcgcactgcaacagatcaacaatcaggtc
acttcgctcgccaatcagacgcagatgctcattaatcaagcgaagcagctaacgaagcta
ccgacgtcagttctctcgcagattgagggcaattttgccgaaatgaagcggctgatgggg
gaggctgataagctggcttacaacgtcagcaatatcgaggcgcagttctcgccgaccttc
cagaactttgcggccggcaagtccgacgctcaacttgccgctttggcacgcgatcgctgg
caacaatccttgtcggcctacgaacattcgctgaaggcgggcgctgtcgctgtgcagaac
ctcgagggcacgcgctcccagaccagcacgctgcttgacaccagccaatcggccgtcggc
ctgctccaggcgacgcaggccggcaaccagcttctcggcgttcaggcacggcaggttgcc
gatctcaccgcgatgctcgccgcacagggcagggccgacgctcttgaaaactcccgcaag
gccgcggcgcaagagcaatcgcgcgagcagttcagccgctttatgatcggaagcagctac
agccccacacccgttcgtatgtttcacgactga

DBGET integrated database retrieval system