KEGG   Afipia carboxidovorans OM5 (Mississippi): OCAR_6427
Entry
OCAR_6427         CDS       T00783                                 
Name
(GenBank) conjugal transfer protein TrbE
  KO
K20530  type IV secretion system protein TrbE [EC:7.4.2.8]
Organism
oca  Afipia carboxidovorans OM5 (Mississippi)
Pathway
oca02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:oca00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    OCAR_6427
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:oca02044]
    OCAR_6427
Enzymes [BR:oca01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     OCAR_6427
Secretion system [BR:oca02044]
 Type IV secretion system
  Trb secretion system protein
   OCAR_6427
SSDB
Motif
Pfam: P-loop_TraG CagE_TrbE_VirB AAA_22 ABC_tran TrwB_AAD_bind AAA_29 AAA_10 ResIII TraG-D_C DUF87 FtsK_SpoIIIE AAA_23
Other DBs
NCBI-ProteinID: ACI93540
Position
complement(2367695..2370199)
AA seq 834 aa
MLNLAEYRKKSAQLADFLPWAALVAPGVVLNKDGSFQRTARFRGPDLDSATPAELVGTTA
RLNNALRRLGSGWAIFVEAQRHPATDYPESLFPDSASALLDIERREQFEDSGVLFESSYF
LTFAWLPPAEETSRMEAWLYEGREHGGVDPWELLKNFVDRTDRVLNLVEGFVPEADWLDD
AETLTYLHSTISTKRHQVRVPETPMHLDALLADQPLAGGLEPRLGDFHVRTLTIIGFPTT
TFPGILDDLNRLAFVYRWSTRAIMLDKTDATRLVTKIRRQWFAKRKSVAAILKEVMTNEQ
SVLLDTDAANKAADADAALQDLGSDQVGEVYVTATVTVWSADRAVADERLRLVEKVIQSH
DFTCIVEGVNAIEAWLGSIPGQTYANVRQPPISTLNLAHMMPLSAVWAGPARDEHLGAPP
LFYAKTEGATPFRFALHIGDVGHTMIVGPTGAGKSVLLALMALQFRRYHHSQVFVFDFGG
SIRAATLAMGGDWLDLGGSLTEDAESTSVSLQPLALIHHVPERAWAADWLVDILLREGVA
ITPEVKEYIWAALTSLASAPVEERTITGLTVLLQSSVLKQALRPYCIGGAHGRLLDAEHE
HLGTATVQAFETEGLIGTKAAPAVLSYLFHRIEARFDGRPSLLVIDEGWRALDDGGFADK
IKEWLKTLRKKNVSVVFSSQSLADIEASPIAPVLVESCPTRIFLANERAIEPQIMTVYER
FGLNARQIEIIARATPKRDYYCQSRRGNRLFELGLGAVALALCASSDKAAHALIDELLRD
GARPYFLEAWLYANDLAWAGDLVPNLTNVIDAIDASAATRQPPRITPSEQERPS
NT seq 2505 nt   +upstreamnt  +downstreamnt
atgctgaatctcgccgaataccggaaaaagagcgcgcagcttgcggactttctgccctgg
gccgcgctggttgcgccgggcgtcgtgctcaacaaggacggatcgtttcaacggacggcg
cgatttcggggtcccgatctcgacagcgcgacgccagccgagctggtcggtacgacagcg
cggcttaacaatgccttgcgccgtctcggctccggctgggcgatcttcgtcgaggcgcag
cgccatcccgccaccgactatccggaaagtctgtttccggactccgcatccgcgctcctc
gatatcgagcgccgcgagcagttcgaggactccggcgtcctgttcgagtcgagttacttc
ctcaccttcgcctggctgccgcctgccgaggaaacctcgcgcatggaagcctggctctat
gagggccgcgagcacggcggcgtcgatccgtgggaactgctgaaaaattttgtcgaccgg
accgaccgcgtgctcaacctggtcgaaggctttgtgccggaagccgactggctcgatgac
gccgagacgctgacctacctacattcgaccatctcgaccaagcggcatcaggtgcgcgtg
cccgagacgccgatgcacttggacgcgctgctggccgatcagccgcttgccggcgggctg
gaaccgcggcttggcgatttccatgtccgcacgctcaccatcatcggattcccgaccacg
acattccccggaattctcgacgacctcaaccggctcgccttcgtctatcgctggtcgacg
cgcgccatcatgctcgacaagacggatgcgacgcggctggtcacgaagattaggcggcaa
tggtttgccaagcgcaaaagcgttgccgcgatcctgaaagaggtgatgacgaacgagcag
tcggtgttgctggacactgacgcggccaacaaggccgccgatgccgacgcggccttgcag
gacctcggctccgatcaggtcggcgaagtctatgtcaccgcgaccgtcaccgtgtggagc
gccgatcgcgccgtcgccgacgaacgactgcggctggtcgaaaaggtcatccagtcgcac
gacttcacctgcatcgtcgaaggcgtcaatgccatcgaagcctggctcggctccatcccc
ggccagacctacgcgaacgtccgccaaccgccgatctcgacgcttaatttggcgcacatg
atgccgctctccgcggtctgggccgggccggcgcgggacgaacatcttggcgcgccgcca
ttattctacgccaagacagaaggggcgacccccttccgcttcgcgctgcatatcggcgac
gtcggccacaccatgatcgtgggaccgaccggggcggggaagtcggtgctactcgcgctg
atggcgctccagttccgacgctatcatcattcgcaggtgttcgtattcgactttggcggc
agcattcgcgctgcgacgctggcgatgggtggcgactggctggacctgggcggttcactc
accgaggacgcggaatccacctcagtttcgctccagccgctggcgctcatccatcacgtt
cccgaacgggcatgggccgccgactggctggtcgacattctcctgcgcgaaggcgtcgcc
atcacgccggaggtcaaggagtacatctgggccgcgctgacttcgctagcttcggcgccg
gtcgaggagcgcaccatcaccggcctgaccgtgctgttgcagtcctcggtgctaaagcag
gcgctgcggccatactgcatcggcggcgcacatggccgtctgctcgatgccgagcacgaa
catctcggcacggcgaccgtccaagccttcgagaccgagggacttatcggcaccaaggcc
gcgccagcggttctctcgtatctgttccaccgcatcgaagcccgcttcgacggacggccg
agcctactcgtcatcgacgaaggctggcgcgcgctcgatgacggcggtttcgccgacaag
atcaaggaatggctcaagacgctgcgaaaaaagaatgtcagcgtcgtgttctcctcgcag
tcgcttgccgacatcgaagcgtcgccgatcgcgcccgtgctggtcgagagttgcccgaca
cgcatcttcctcgccaacgaacgcgccatcgagcctcagatcatgaccgtctatgagcgg
ttcgggctcaatgcccggcagatcgaaatcatcgcgcgggcgaccccgaagcgcgactac
tactgccagtcacgacgcggcaaccggctgttcgagcttggtcttggcgctgtcgcactg
gcgctctgcgcatcgtcggacaaggccgcgcacgcgctgatcgacgagctactgcgcgac
ggcgcacggccgtacttcctcgaagcgtggctctacgccaacgacctcgcctgggccggc
gacctcgttcccaatctcaccaatgtcatcgatgcgatcgatgcgtccgccgcgacgcgt
cagccgccgcgcatcacgccgtcagaacaggagaggccatcatga

DBGET integrated database retrieval system