KEGG   Afipia carboxidovorans OM5 (Mississippi): OCAR_6441
Entry
OCAR_6441         CDS       T00783                                 
Name
(GenBank) trag family protein
  KO
K03205  type IV secretion system protein VirD4 [EC:7.4.2.8]
Organism
oca  Afipia carboxidovorans OM5 (Mississippi)
Pathway
oca03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:oca00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    OCAR_6441
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:oca02044]
    OCAR_6441
Enzymes [BR:oca01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     OCAR_6441
Secretion system [BR:oca02044]
 Type IV secretion system
  Conjugal DNA-protein transfer (VirB/D) protein
   OCAR_6441
SSDB
Motif
Pfam: T4SS-DNA_transf TraG-D_C TrwB_AAD_bind
Other DBs
NCBI-ProteinID: ACI93554
Position
complement(2384638..2386653)
AA seq 671 aa
MSTSRVAWGQIVVVFAIVLLAVWSATQWVAWRLGFQQQLGSSWFSLAGLPIYPPPAFFWW
WFFFDAYAPHIFLEGAGIAASGGLVAIVVAILMSIYRAREAKDVRTFGSARWAEPDEIEA
AGLLGDDGVVLGRLDRTYLRHDGAEHVLCFAPTRSGKGVGLVVPTLLTWPGASIVHDIKG
ENWELTAGFRARFGRVLLFDPTNANSAAYNPLIEVRKGEWEVRDVQNVADVLVDPEGSLE
KRNHWEKTSHSLLVGAILHVLYAEKDKTLAGVAAFLSDPRRPIESTLSAMMTTPHLGEKG
PHPVIASAARELLNKSDNERSGVLSTAMSFLGLYRDPVVAAVTARCDWRITDLVSGDKPT
TLYLVVPPSDISRTKPLVRLVLNQIGRRLTEDLHAKGRRHRLLLMLDEFPALGRLDFFES
ALAFMAGYQIKAFLISQSLNQIEKAYGQNNSILDNCHVRVSFATNDERTAKRVSDALGTA
TEMRAMQNYAGHRLAPWLGHLMISRSETARPLLTAGEVMQLPPDDEIVMVAGVPPVRARK
ARYYEDARFKERLLPVPQNPKAGLTPKPDDWSALKPVAAPTGNSAAAQQSAPPATGAAKP
DDDPANSGLRREPGLEWHKDIAPEPVRTPANEFDPDADEPERKVAANRVLAHDMRLMARR
IALDPGDGMEL
NT seq 2016 nt   +upstreamnt  +downstreamnt
gtgtcaaccagccgtgttgcgtggggccagatcgttgtcgtgttcgctatcgtgctgctc
gcggtctggagcgcgacgcagtgggttgcgtggcgcctcggctttcagcagcaactcggc
tcatcttggttttcgctggccggcctgccgatctatccgccgccggcctttttctggtgg
tggttcttcttcgatgcctacgcgccgcacatttttctggagggtgccgggatcgccgcc
tcgggtggcctcgtcgcgatcgtcgtcgcaatcctcatgtcgatctaccgtgcgcgcgag
gccaaggatgtgcgcacattcggctcggctcgctgggccgagccggatgagatcgaagcc
gcgggcctgctcggagacgatggagtcgttctcggccgcctggaccgaacctatctgcga
cacgatggcgccgagcatgtcctgtgcttcgcgccgacgcggagcgggaagggtgtcggt
ctcgtggtaccgacgttactcacatggcccggcgcgtcgatcgtgcatgatataaaagga
gaaaattgggaattgaccgcgggctttcgggcacggtttggccgagtgttgctgttcgat
ccgaccaatgcgaactcggccgcctacaatccgctgatcgaggtgcgcaaaggcgaatgg
gaagtgcgagacgtccagaacgtcgccgacgtgctagtcgatccggagggttcgttggag
aagcgcaatcattgggagaaaacatcccattcactgctggtcggcgccatcctccatgtc
ctctatgccgagaaggacaagacgctcgccggtgtcgccgcctttctgtcggacccgcgg
cgacccatcgagtcgacgctgtccgccatgatgacgacgccgcatctcggcgagaagggg
ccgcatcccgtcatcgccagcgcggcacgcgaactgctcaacaagtcggacaacgaacgc
tccggcgtcttgagcacggccatgtcattcctcggcctctatcgcgatcccgtcgttgcc
gcagtgacggcccgctgcgattggcgcatcacggatctcgtgtccggcgataagcccacc
acgctctacctagtggtgccaccatccgatatcagcaggacgaagccgctcgtgcgcctc
gtgcttaaccagatcgggcggcggctgaccgaagacctgcacgcgaaaggccgccgtcat
cgcctgttgctgatgctcgatgaatttccggcgctcggccggctcgacttctttgaatct
gcgctcgccttcatggccggctatcagatcaaggcatttcttatctctcaatcattaaac
caaatcgagaaagcctacggtcagaacaactccatcctcgacaattgccatgtgcgcgtg
agtttcgcgaccaacgacgagcgtaccgcgaagcgcgtatcggacgcgctcggcacggca
acggagatgcgcgccatgcagaactatgccggtcatcgtctcgcgccctggctcggacac
ttgatgatttcacgctccgagaccgcgcggccgctgctcaccgcaggcgaggtgatgcag
cttccgcccgacgacgagatcgtcatggtcgccggcgtgccgccagtccgcgccagaaag
gcgcgctattacgaagatgcgcggttcaaggaacggttgctgcctgttccgcagaacccg
aaagccggcctcacgccgaagcctgacgactggtcggcgctgaagccagtcgcggcgccg
acgggcaacagcgccgctgcacagcaaagtgcgccaccagcgacaggtgcggccaagccg
gatgacgatccagccaattcggggctccgccgcgaacctgggcttgagtggcataaggac
atcgcgccggagccggtgaggactcctgccaacgagttcgatcccgatgctgatgagccg
gagcgtaaggttgcagccaaccgggtgctggcgcacgacatgcgactgatggcccggcgg
atcgcgttggaccccggcgatggcatggagttgtag

DBGET integrated database retrieval system