KEGG   Afipia carboxidovorans OM5 (Mississippi): OCAR_6444
Entry
OCAR_6444         CDS       T00783                                 
Name
(GenBank) lytic transglycosylase, catalytic
Organism
oca  Afipia carboxidovorans OM5 (Mississippi)
SSDB
Motif
Pfam: SLT SLT_2 SLT_4 Transglycosylas
Other DBs
NCBI-ProteinID: ACI93557
Position
complement(2389520..2390281)
AA seq 253 aa
MASRAGGSCALLSSIMATLIACGVIVAAASCASADPPPTRRVSTAGTVDPWAAHIAEAAK
RFTIPERWIRAVMTVESSGDRTARSPKGAMGLMQIMPKTWNELHARYGLGSDPWQPRANI
MAGAAYLREMHDRYGSIVAMLAAYNAGPTRYDAHLANGRALPAETVEYVAKIASMIGGKV
PVMRMAGIASRRSWSRGPIFVGRSAVHPDDGSTMSDLPSGRLSSAPAIVDLSALMPLSDD
LFVRRPHADGEQR
NT seq 762 nt   +upstreamnt  +downstreamnt
atggcgtctcgggctggcggttcttgcgctctcctgtcgtcgatcatggcgacgttgatc
gcgtgcggcgtaatcgttgccgccgcatcttgtgcgtcggccgatccgccgcccacacgt
cgcgtctcgaccgccggaacggtcgatccttgggcggcgcatatcgcagaggcggcgaag
cgtttcaccattcccgaacgctggatacgcgcggtcatgaccgtcgaaagctccggcgac
cggaccgcgcgatcgcccaagggcgcgatgggcctgatgcagatcatgccgaagacgtgg
aacgaactgcacgcgcggtacggcctcggcagcgatccctggcagccgcgcgccaacatc
atggccggcgcggcttacctgcgcgagatgcacgatcgctacggctcgatcgtcgcgatg
ctcgccgcctataatgcaggtccgacgcgctacgacgcacaccttgcgaacggccgcgcg
ctgccggccgagaccgtcgaatacgtcgcgaagatcgcgtcgatgatcggcggcaaggtg
cctgtcatgcggatggccggcatcgcctcgcgtcgatcttggtcccgcggaccgatcttc
gtcgggcgatccgccgttcatcccgacgacggttcgacgatgtccgatcttccttccggc
cgactatcgagcgcacctgcgatcgtcgatctgtcggcgctcatgccgctgtccgatgat
ctcttcgtgcgaaggccgcacgccgatggagaacagcgatga

DBGET integrated database retrieval system