KEGG   Afipia carboxidovorans OM5 (Mississippi): OCAR_6448
Entry
OCAR_6448         CDS       T00783                                 
Name
(GenBank) conjugal transfer protein
Organism
oca  Afipia carboxidovorans OM5 (Mississippi)
SSDB
Motif
Pfam: Peptidase_S26
Other DBs
NCBI-ProteinID: ACI93561
Position
complement(2391103..2391663)
AA seq 186 aa
MIERRATLLSVLASVALIVAPSWSPPNIRFIWNASASVPVGLYRIVPGDHVDVTDLAVVM
PPAELAAFLDERRYLPRGLPLIKRVLALGGATVCRRGSAIIAYGGIYGQALARDTRGRPL
PDWQGCRTLGAGEAFFMNWDSPDSFDSRYFGPLPVTTIVGRAIPVWTTDATDPAAESLRA
PVSDEP
NT seq 561 nt   +upstreamnt  +downstreamnt
atgatcgagcgccgcgcaacgcttctttcggtgctcgccagtgtggcgctgatcgtcgcg
ccaagctggagccctccgaacattcgcttcatctggaacgcatccgccagcgttccggtc
gggctctaccggatcgtgcccggcgatcatgtcgacgtcaccgatctcgccgtcgtcatg
ccgcccgcggagctggcggcgtttctcgacgaacgccgctacttgccgcgcggcctgccg
ctcatcaagcgcgtgctggcgctcggtggcgcgaccgtctgccggcgtggcagcgccatc
atcgcctatggcggaatctacgggcaggcgctcgcgcgcgatacgcgcggtcgcccgctg
cccgattggcagggctgccgcacgctcggcgccggcgaagccttcttcatgaactgggac
agccccgacagcttcgacagccgctatttcgggccgcttcccgtcaccacgatcgtcggc
cgcgccattcccgtctggaccaccgacgccaccgatccggccgcggaatccctccgcgcg
ccggtctcagacgagccgtga

DBGET integrated database retrieval system