KEGG   Oligotropha carboxidovorans OM5 (Mississippi): OCAR_7442Help
Entry
OCAR_7442         CDS       T00783                                 

Definition
(GenBank) 3-ketoacyl-CoA thiolase B, peroxisomal
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
oca  Oligotropha carboxidovorans OM5 (Mississippi)
Pathway
oca00071  Fatty acid degradation
oca00072  Synthesis and degradation of ketone bodies
oca00280  Valine, leucine and isoleucine degradation
oca00310  Lysine degradation
oca00362  Benzoate degradation
oca00380  Tryptophan metabolism
oca00620  Pyruvate metabolism
oca00630  Glyoxylate and dicarboxylate metabolism
oca00640  Propanoate metabolism
oca00650  Butanoate metabolism
oca00900  Terpenoid backbone biosynthesis
oca01100  Metabolic pathways
oca01110  Biosynthesis of secondary metabolites
oca01120  Microbial metabolism in diverse environments
oca01130  Biosynthesis of antibiotics
oca01200  Carbon metabolism
oca01212  Fatty acid metabolism
oca02020  Two-component system
Brite
KEGG Orthology (KO) [BR:oca00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    OCAR_7442
   00630 Glyoxylate and dicarboxylate metabolism
    OCAR_7442
   00640 Propanoate metabolism
    OCAR_7442
   00650 Butanoate metabolism
    OCAR_7442
  09103 Lipid metabolism
   00071 Fatty acid degradation
    OCAR_7442
   00072 Synthesis and degradation of ketone bodies
    OCAR_7442
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    OCAR_7442
   00310 Lysine degradation
    OCAR_7442
   00380 Tryptophan metabolism
    OCAR_7442
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    OCAR_7442
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    OCAR_7442
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    OCAR_7442
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:oca04147]
    OCAR_7442
Enzymes [BR:oca01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     OCAR_7442
Exosome [BR:oca04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   OCAR_7442
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt UCMA
Motif
Other DBs
NCBI-ProteinID: ACI94545
UniProt: B6JJF1
Position
complement(3398125..3399312)
Genome map
AA seq 395 aa AA seqDB search
MSDAVIVSTARTPIGKAYRGALNATEGATLFAHAIKAAVERAQLDPAEVEDVVMGAALQQ
GATFANIARKALLRAGLPVTVAGTTVDRQCASGLQAIANAARSVLFDGVGIAVAGGGESI
SLVQNDKMNMFHAVDPALQEIKPDIYMSMLDTAEVVAKRYGISRERQDEYALESQRRIAA
AQQAGRFKDEIAPISTTMGVLDKASGEVSFKDVTLSQDEGPRPDTTAEGLAALKPVKGEG
FTITAGNASQLSDGASAVVVMSDKTAAQRNLKPLGIFRGMVSVGCEPDEMGIGPVFAVPR
LLKRHGLSVDDIDLWELNEAFAVQVVYCRDKFGLDPEKLNVNGGAIGVGHPYGMTGARLA
GHVLIEGRRRKAKYAVVTMCVGGGMGSAGLFEIVQ
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgtccgatgccgtcatcgtttccacagcccgcacgccgatcggcaaggcctatcgtggt
gcactgaatgccactgaaggcgcgacgctgttcgcacatgcgatcaaagccgcggtggag
cgggcgcagctcgaccctgccgaggtggaggacgtggtgatgggtgccgcgctgcagcaa
ggggcgacctttgccaacatcgcacgcaaggcactgctgcgtgcgggtctgcccgtcacg
gtcgccggcaccacggtggaccgtcagtgtgcatcgggtctacaggcgattgcgaatgcg
gcgcgctcggtgctgttcgatggcgtcgggatcgcggtggcgggcggcggcgaatcgatc
agcctcgttcagaacgacaagatgaacatgtttcatgcggtcgatccggcgctgcaggag
atcaagcccgatatttacatgtcgatgctcgacaccgccgaggtggtggcgaagcgctac
ggcatttcgcgcgagcggcaggatgagtacgcgctggaaagccagcgccgcatcgccgcc
gcgcagcaggcgggccggttcaaggatgagatcgcgccaatttcaacgacaatgggcgtg
ctcgacaaggcaagcggcgaggtgtcgttcaaggacgtgacgctttcgcaggatgaaggc
ccgcgacccgatacaacggcggagggcctggccgcgctgaagccggtgaagggcgaaggc
ttcaccatcaccgccggcaatgcgagtcagctctccgatggcgcgagcgccgtggtggtg
atgagcgacaagacggccgcgcagcgcaacctgaagccgctcggtatcttccgtggcatg
gtgtcggtcggctgcgagccggacgagatgggcatcggcccggtgttcgcggtgccgcgg
cttctcaagcgtcacggcctgagcgtggatgatatcgatctgtgggaattgaacgaggca
ttcgcggtgcaggtcgtctattgccgcgacaagttcgggctcgatcccgagaagctcaac
gtcaacggcggcgccatcggcgtcggccacccctatggcatgaccggcgcgcggcttgcg
ggccatgtgctgatcgaagggcggcggcgcaaggcgaaatacgcagtggtgacgatgtgc
gtcggcggcggcatgggctcggccggtctgttcgagatcgtgcagtag

DBGET integrated database retrieval system