KEGG   Afipia carboxidovorans OM5 (Mississippi): OCAR_7697
Entry
OCAR_7697         CDS       T00783                                 
Name
(GenBank) conjugal transfer protein
Organism
oca  Afipia carboxidovorans OM5 (Mississippi)
SSDB
Motif
Pfam: T4SS HOASN
Other DBs
NCBI-ProteinID: ACI94795
Position
3660525..3661241
AA seq 238 aa
MRWIFVLAVLTLTFTDAPPAMAQVPVLDSANLAKAQQIATSTQQILTADQQILQFTQKTL
QAVTGDRSSQAQGTLAQMALGGGFSMAQAPSLGSVISGGALSFAGMGSASQNIVSTLING
LQLVQTITGLVSGQTHPADTAYKNSVNVAATLSGLINSTQSAVQQRSSAFTQGGQQIGKA
QDLKGSVDQNTQVQIQTGQTINELNGVVNNAAAAANQANLDRIAAESSAARAMKFTQQ
NT seq 717 nt   +upstreamnt  +downstreamnt
atgcgttggatattcgtgctcgctgtgttgacgctgacttttacggacgcgccgccggcg
atggcgcaggttcccgtcctcgacagcgcgaacctcgccaaagcgcagcagatcgcgacc
agcacccagcagatcctcaccgcggatcaacagatcctccagttcacgcaaaagacattg
caagccgtcaccggcgatcgctcatcgcaggcgcaggggacgctggcccagatggcgctc
ggcggcggcttctcgatggcgcaagcaccgtccctcgggtcggtgatttcgggcggggcc
ttgtcgttcgcgggcatggggtcggcgtctcagaacatcgtctcgaccctcattaacgga
ctgcagttggtgcagaccattaccggcctcgtcagcggtcagacccatcccgccgatacg
gcctacaagaactccgtcaatgttgcggcaacgctgtccggactgatcaactcgacacag
agcgccgtacagcagcgatcgtcagcgttcacgcaaggcgggcaacaaatcggcaaggcg
caagacctcaaaggcagcgtcgatcagaacacccaggtgcaaatccagaccgggcaaacc
atcaacgagctcaacggcgtcgtcaacaacgccgcggccgccgccaatcaagcaaacctc
gatcgcattgccgcggaatcgtccgccgcccgcgcgatgaaattcacacagcagtaa

DBGET integrated database retrieval system