KEGG   Oligotropha carboxidovorans OM5 (Mississippi): OCAR_7701Help
Entry
OCAR_7701         CDS       T00783                                 

Definition
(GenBank) VirB8
  KO
K03203  type IV secretion system protein VirB8
Organism
oca  Oligotropha carboxidovorans OM5 (Mississippi)
Pathway
oca03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:oca00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    OCAR_7701
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:oca02044]
    OCAR_7701
Secretion system [BR:oca02044]
 Type IV secretion system
  Conjugal DNA-protein transfer (VirB/D) protein
   OCAR_7701
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: VirB8 T7SS_ESX1_EccB
Motif
Other DBs
NCBI-ProteinID: ACI94799
UniProt: B6JK49
Position
3662784..3663500
Genome map
AA seq 238 aa AA seqDB search
MTETVTSEPARVDPRYYADGATWERDIARRNRNSRALAWIVATVMSVVAVGALGTLALLV
PLKTYEPYMVVVDKTTGFVEVKRPMAEGPLTQDEAVTTFNVVRYIKARETYDPKALKDNF
DLAQLLATGDAARELTEIYSPANPNNPVKVYGTNTVVAVTIKSVTFPNNRTALARFSTEE
KSSTNVITRNWVSLVRFRYTSAPMRNEWRFDNPLGFQVLEYRRDQETAPSPGTVGAQQ
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgacggaaaccgtgacatcagagcccgcgcgcgtcgatccgcgctactatgccgacggc
gcgacatgggagcgcgacatcgcgcggcggaatcgcaactcccgcgcgctggcctggatc
gtcgcgaccgtgatgagcgtggtcgcagtcggggcgctcggaacactcgccctgctcgtc
ccgctcaagacctacgagccttatatggtcgttgtcgacaagacgaccggcttcgtcgag
gtgaagcgcccgatggccgaaggcccgttgacccaggacgaagcggtgacgacgttcaac
gtcgtccgttacatcaaggcgcgggaaacttatgaccccaaggcgttgaaggacaacttc
gacctcgcccagctgctggcgacgggagacgcagcgcgtgagctcacggaaatctactcg
cccgccaatccgaacaatcccgtcaaggtctacggcaccaacactgttgtcgcggtcaca
atcaaatccgtgaccttcccgaacaatcgaaccgcgctggcgcggttttcgaccgaggag
aaatcatcgaccaacgtcattacgcgcaactgggtctcgctcgtgcggttccgctatacc
tccgcgccgatgcgcaatgagtggcgcttcgacaatccgctcggcttccaggtgctggaa
tatcgccgcgatcaggaaacggcgccgtcgcccggaactgtgggtgcgcaacaatga

DBGET integrated database retrieval system