KEGG   Oceanicola sp. D3: FHY55_00070Help
Entry
FHY55_00070       CDS       T06139                                 

Gene name
ggt
Definition
(GenBank) gamma-glutamyltransferase
  KO
K00681  gamma-glutamyltranspeptidase / glutathione hydrolase [EC:2.3.2.2 3.4.19.13]
Organism
ocd  Oceanicola sp. D3
Pathway
ocd00430  Taurine and hypotaurine metabolism
ocd00460  Cyanoamino acid metabolism
ocd00480  Glutathione metabolism
ocd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ocd00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    FHY55_00070 (ggt)
   00460 Cyanoamino acid metabolism
    FHY55_00070 (ggt)
   00480 Glutathione metabolism
    FHY55_00070 (ggt)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ocd01002]
    FHY55_00070 (ggt)
Enzymes [BR:ocd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.2  gamma-glutamyltransferase
     FHY55_00070 (ggt)
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.13  glutathione gamma-glutamate hydrolase
     FHY55_00070 (ggt)
Peptidases and inhibitors [BR:ocd01002]
 Threonine peptidases
  Family T3: gamma-glutamyltransferase family
   FHY55_00070 (ggt)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G_glu_transpept
Motif
Other DBs
NCBI-ProteinID: QDC07737
UniProt: A0A5B8BL90
Position
complement(11006..12727)
Genome map
AA seq 573 aa AA seqDB search
MKPVIAGALALSLVAAPGVAQEAAIFSGDDRIHPVYAQNGMVSAQEAVAAQVGLDILQAG
GNAVDAGVAVAFALAVTLPRAGNLGGGGFMIVHDAESGETKAIDYREMAPASADRDMFLD
AEGNADSNLSRFTGLATGVPGTVAGMQMALEEYGTMTMAEVVAPAIALARDGIDVTPGLA
DSLKGLEKRLKAHPSSEAIFYKEGGAFYEPGERLVQADLAQTLQKIADEGPAGFYEGAVA
EAISKAVMDAGGRITPEDMANYKAVLREPVTGSYRGYEIVSMPPPSSGGAHIVQILNVLE
EYPVGFLGHNSAETIHLMAEAMKRAYADRSEYLGDSDYVDVPLAEITSKDYAAAIRGEIS
RNVATPSSTIKPGNLAPYESNETTHFSIVDKDGNAVSNTYTINFSYGSGMVAEGTGVLMN
NEMDDFAAKPGVPNAYGLIGGDANAVEGGKRPLSSMSPTLVMKDGEVFMVTGSPGGSRII
TTTLQVIMNVIDHGMNIAEASTAPRIHHQWLPDEIRIEEGISPDTIAILEQKGHKVARKT
VMGSTQSIMVDKESGLLFGASDPRRVDAATVGY
NT seq 1722 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccagtcatcgcgggggcactggccctttcgcttgtcgccgcgccgggggtggcg
caggaagcggcgatcttctcgggcgacgaccggattcatccggtctacgcgcaaaacggc
atggtctcggcgcaggaggcggtggccgcgcaggtcgggctcgacatcttgcaggccggc
ggcaacgcggtggatgcgggcgtggccgtggccttcgccctggccgtcaccctgccccgc
gcgggcaaccttggcggcggcggcttcatgatcgtgcatgacgcagagagtggtgagacc
aaggcgattgattaccgcgagatggcgcccgcgagcgccgaccgcgacatgtttctggac
gccgagggcaatgccgatagcaacctcagccgcttcaccgggctggccaccggcgtgccc
ggcaccgttgcgggcatgcagatggcgctggaggagtacgggaccatgacgatggccgag
gtcgtcgcccctgccatcgcgctcgcccgcgacgggatcgacgtgacaccgggccttgcc
gacagcctgaaggggctcgaaaagcggcttaaggcgcatccctcctccgaggcgatcttc
tacaaggaaggcggcgctttttacgagcccggtgagcggctggtgcaggccgatctggcg
cagacacttcagaagatcgccgacgaggggccagcaggcttttacgagggcgcggtggcc
gaggcgatcagcaaggcggtgatggacgcgggcgggcggatcacacccgaggacatggcg
aactacaaggcggtgctgcgcgagcccgtcaccggcagctaccgtggctacgagatcgtc
tcgatgccgccgccgtcgtctggcggggcgcatatcgtgcagatcctcaacgtgctggag
gagtatccggtaggcttcctcggccataactcggcggagacgatccacctgatggccgag
gcgatgaagcgcgcctacgccgaccgttccgagtatctgggtgatagcgactacgtcgat
gtgccgctggccgaaatcacctcaaaggactacgccgcagccatccggggcgagatcagc
cgcaacgtggccacaccctccagcaccatcaagccgggtaatctcgcgccctacgaaagc
aacgagaccacccatttctcgattgtcgacaaggacggcaacgcggtgtccaacacctac
accatcaacttctcctacggctcgggaatggtggccgagggcaccggcgtgttgatgaac
aacgaaatggacgacttcgccgccaagcccggcgtgcccaatgcctacgggctgatcggc
ggggatgccaacgcggtggagggcggcaaacgcccgctgtcgtcgatgagcccgacgctg
gtgatgaaagatggcgaggtgttcatggtgacgggtagcccgggtggcagccgcatcatc
accaccaccttgcaggtcatcatgaacgtgatcgaccacggcatgaacatcgccgaagcc
tccaccgccccccgcatccaccaccaatggctgcccgacgagatccgcatcgaagaaggc
atcagccccgacaccatcgcgatccttgaacagaagggtcacaaggtggcgcgcaaaacg
gtgatgggctcgacccaatcgatcatggtcgacaaggagagcgggctgctcttcggcgct
tccgacccccgccgggtagacgccgccactgtcggctactga

DBGET integrated database retrieval system