KEGG   Oceanicola sp. D3: FHY55_07750Help
Entry
FHY55_07750       CDS       T06139                                 

Definition
(GenBank) inorganic phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
ocd  Oceanicola sp. D3
Brite
KEGG Orthology (KO) [BR:ocd00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    FHY55_07750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: QDC09140
Position
1510975..1512459
Genome map
AA seq 494 aa AA seqDB search
MSESDYDASHLETLDRDLGRISNLELATGYVARPMVGYGIAFVFVVLAGLVAALIFGQTT
SSFIVIIAAVFGAYMALNIGANDVANNMGPAVGANALTMGGAIAIAAVFESAGALIAGGD
VVSTIAKGIIAPDSMGSANTFVWAMMAALLSSALWVNLATWVGAPVSTTHSVVGGVMGAG
IAAAGFAAVSWGTMGAIAASWVISPVLGGIIAAGFLWFIKSNIIYVDDKIAAARRWVPVL
VGIMGGAFASYIALKGIKKLVKIDMLTALGAGVAVAVLIWLVMIPVIRRQSEGLENRNRS
LKVLFGIPLIVSAALLSFAHGANDVANAVGPLAAIVQALGTGDFTHAVAIPYWVMVIGAL
GISFGLFLFGPKLIRMVGSQITKLNPMRAYCVALSAAITVIVASWLGLPVSSTHIAVGGV
FGVGFFREWDYERRLRRARGSLPDRPLHGAEERRRRKLVRRSHFMTIIAAWIITVPAAAV
LSALLFWGMVTVAG
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
gtgtcagaatccgactatgacgccagccatctggaaacgctggaccgtgacctaggccgc
atctccaacctcgagcttgccacgggatacgtggcgcggccgatggtgggctatggcatc
gcctttgtcttcgtggtgcttgcgggcctcgtggccgcgctcattttcggacaaaccacc
agcagtttcatcgtgatcatcgccgccgtcttcggggcctatatggcgctgaacatcggt
gccaatgacgtggccaacaacatgggcccggcggtgggggcgaatgcgctgaccatgggc
ggggcgattgccattgccgccgtgttcgagagcgcgggtgcgctgattgcgggcggcgat
gtggtgagcaccattgccaaggggatcatcgcgcccgatagcatgggctctgccaacacc
ttcgtttgggcgatgatggcggcgctgctctcttccgcgctttgggtgaaccttgccaca
tgggtcggcgcgccggtttcgaccacccacagcgttgtgggcggggtgatgggcgcgggc
attgccgccgcgggctttgccgccgtgagctggggcaccatgggcgcgattgcggcgagc
tgggtgatttcgccggtgctgggcggcatcatcgctgcgggcttcctgtggttcatcaaa
tccaacatcatttacgtcgatgacaagatcgccgccgcgcggcgctgggtgccggtgctg
gtgggcatcatgggcggggcctttgccagctatatcgcgctgaagggcatcaagaagctg
gtgaagatcgacatgctgaccgcactgggcgcgggcgttgccgtggcggtgctgatctgg
ctggtgatgatcccggtgatccgccgccaatccgaagggctggaaaaccgcaaccgctcg
ctgaaggtgctctttggcattccgctcatcgtctctgcggcgctgctcagctttgcccac
ggggccaatgacgtggccaatgcggttggcccgctggcggcgattgtgcaggcgctgggc
accggggatttcacccatgcggtggccattccctattgggtgatggtgatcggcgcgctg
ggcatcagctttggcctcttcctctttggccccaagctgatccggatggtgggcagccag
atcaccaagctgaacccgatgcgggcctattgcgtggcgctctcggcggccatcacggtg
atcgtggccagctggctggggctgccggtgtcgtcgacccatatcgcggtgggcggggtc
tttggcgtggggttcttccgcgagtgggattatgagcggcggctgaggcgggcgcgcggc
tcgctgcccgaccgcccgctgcatggcgcagaagagcgccgccgccgcaagctggtgcgg
cgctcgcatttcatgacgatcatagccgcgtggatcatcaccgtcccggccgccgccgtg
ctttcggcgctgctgttctggggcatggtgacggttgctggataa

DBGET integrated database retrieval system