KEGG   Oceanicola sp. D3: FHY55_14915Help
Entry
FHY55_14915       CDS       T06139                                 

Definition
(GenBank) phosphatidylserine decarboxylase
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
ocd  Oceanicola sp. D3
Pathway
ocd00564  Glycerophospholipid metabolism
ocd01100  Metabolic pathways
ocd01110  Biosynthesis of secondary metabolites
Module
ocd_M00093  Phosphatidylethanolamine (PE) biosynthesis, PA => PS => PE
Brite
KEGG Orthology (KO) [BR:ocd00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    FHY55_14915
Enzymes [BR:ocd01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     FHY55_14915
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PS_Dcarbxylase
Motif
Other DBs
NCBI-ProteinID: QDC10454
UniProt: A0A5B8BWN0
Position
complement(2991722..2992411)
Genome map
AA seq 229 aa AA seqDB search
MKLHETFIKPMHREGWRFVGVFAVLTLLLFFIWTPLGLIGLVLTIWCYYFFRDPVRHVPD
ADGLIVSPADGIVSLIEMATPPPELGLGEEKRLRVSVFMSVFNCHINRAPVPGRISKMAY
KPGKFLSAELDKASEDNERNSLLIEMDDGRDLVVTQIAGLVARRIVPLTEEGAVLKRGER
FGLIRFGSRLDTYLPEGVQPLVSVGQTMIGGECVLADLNNSTPRPARAD
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
gtgaaactgcacgaaacgtttatcaagcccatgcaccgtgagggctggcgctttgtcggc
gtcttcgcggtgctgacgctgttgctctttttcatctggacgccgctgggcctgattggc
ctcgtgcttacgatctggtgctactactttttccgcgatccggtgcgccatgtgccggat
gccgatgggctgatcgtaagccccgcagacggcattgtgagcctcatcgagatggccaca
ccgccgcccgagttgggcctgggcgaagaaaagcgcctgcgggtgagcgtgttcatgtcg
gtcttcaactgccatatcaatcgcgcgccggtgcccgggcggatttcgaagatggcctat
aagcccggcaagtttctctcggccgaactcgataaggccagcgaagacaatgagcgcaac
tccctgctgatcgagatggatgatggccgcgacctcgtggtgactcaaatcgccgggttg
gtggcgcgacggatcgtgccgctgaccgaggagggcgcggtgctgaagcgcggcgagcgc
tttggcctcatccgttttggctcccggctcgacacctatttgcccgaaggcgtgcagccg
cttgtctcggttgggcagacgatgatcgggggcgagtgtgtgctggctgatctgaacaat
tccacaccccgcccagcgagggcagactga

DBGET integrated database retrieval system