KEGG   Oceanicola sp. D3: FHY55_18565Help
Entry
FHY55_18565       CDS       T06139                                 

Definition
(GenBank) HAD family phosphatase
  KO
K01560  2-haloacid dehalogenase [EC:3.8.1.2]
Organism
ocd  Oceanicola sp. D3
Pathway
ocd00361  Chlorocyclohexane and chlorobenzene degradation
ocd00625  Chloroalkane and chloroalkene degradation
ocd01100  Metabolic pathways
ocd01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ocd00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    FHY55_18565
   00361 Chlorocyclohexane and chlorobenzene degradation
    FHY55_18565
Enzymes [BR:ocd01000]
 3. Hydrolases
  3.8  Acting on halide bonds
   3.8.1  In carbon-halide compounds
    3.8.1.2  (S)-2-haloacid dehalogenase
     FHY55_18565
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like
Motif
Other DBs
NCBI-ProteinID: QDC11113
UniProt: A0A5B8BXD6
Position
complement(3692575..3693195)
Genome map
AA seq 206 aa AA seqDB search
MPVSAVIFDIGNVLIEWNPERFYDAEIGQERRERLFSEVDLHGMNDRVDRGETFRDMVME
CAGANPDWHDEITLWHDRWIEMAQPAIDHSVRLLRALRAGGVPVFALSNFGIQSFELGES
HYPFLAEFDRRYISGHMGVAKPDPEIYAMVEEDCGVAPEALLFADDRDDNIAMAKSRGWQ
THLFEHPAGFANRLVAEGLLTEDSAR
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgcccgtcagcgccgtcatctttgacatcggcaatgtgcttatcgagtggaaccccgag
cggttttacgatgccgagattgggcaggagcggcgagagcggcttttttccgaggtcgac
ctgcacgggatgaacgaccgggtggaccggggcgagacctttcgggacatggtgatggaa
tgcgccggggcgaacccggattggcatgatgagatcacgctatggcacgaccgctggatc
gagatggcgcagccagcaattgaccattcggtgcgcctgctgagggcgctccgcgcgggc
ggcgtgcccgtcttcgctttgtcgaacttcggcatccaaagcttcgagctaggcgaaagc
cactacccgtttttggccgagttcgaccggcgctatatttctggccacatgggcgtggcc
aagcctgacccggagatttacgccatggtcgaggaggactgcggcgtggcccccgaggcc
ctgctgtttgcagatgaccgtgacgacaacattgccatggccaaatcgcgtggttggcag
acccatctgtttgagcacccggcggggtttgcaaacaggctcgtagccgaggggctgctc
accgaggacagcgcaagatga

DBGET integrated database retrieval system