KEGG   Oceanimonas sp. GK1: GU3_02405Help
Entry
GU3_02405         CDS       T01667                                 

Definition
(GenBank) Uroporphyrinogen-III synthase
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
oce  Oceanimonas sp. GK1
Pathway
oce00860  Porphyrin and chlorophyll metabolism
oce01100  Metabolic pathways
oce01110  Biosynthesis of secondary metabolites
oce01120  Microbial metabolism in diverse environments
Module
oce_M00121  Heme biosynthesis, glutamate => heme
oce_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:oce00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    GU3_02405
Enzymes [BR:oce01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     GU3_02405
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4
Motif
Other DBs
NCBI-ProteinID: AEY00238
UniProt: H2G0Z7
Position
complement(510708..511463)
Genome map
AA seq 251 aa AA seqDB search
MIPLVVRPEPQNHRLCEALRQAGHQPVATPLLSFAPGAELAQAPRLLGELGSRDYVIAVS
VAAVNFADNALKTRGQPWPDVTYVAVGEATGRALAAVGVPHALVPDDPRSEGMAALPELQ
NPAGCRVLILRGDGGRDMMAPTLTQRGAQVAYCEVYRRCYRDDAGEQLVKEWQRQGVDSI
IITSGGLLQHLFQLAADSAKDWLLSRLLIVPSIRVTEQAKALGFTHIINAKGASNPALLS
ALDERKRNDRQ
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
gtgatcccgctggtggtgcgtcccgagccgcaaaaccaccgcctgtgcgaggccctgcgc
caggccggccaccagccggtggccacgcccctgctgagctttgcccccggcgccgagctg
gcgcaggcgccccgtctgctgggggagctcggcagccgggattatgtgattgcggtcagc
gtagcggcggtgaatttcgccgataatgccctcaaaacgcgcggacagccctggcccgac
gtcacctatgtggcggtgggtgaagccaccggccgggcgttggccgccgtgggcgtgccc
catgcactggtgccggacgacccccgctccgagggcatggcggccctgcccgagctgcag
aacccggccggatgccgcgtcttgatcctgcgcggcgacggcggccgggacatgatggcc
cccaccctgacacagcggggggctcaggtggcctactgcgaagtctaccggcgctgctat
cgtgatgatgccggtgaacaactggtgaaagagtggcaacgccagggggtggacagtatt
atcatcaccagtggcggcctgctgcagcacctgtttcagcttgcggccgacagcgcaaag
gactggctgctaagccgtttattgattgtgcccagcattcgcgtgaccgaacaggcgaag
gccttgggcttcactcatatcatcaatgccaaaggtgcatccaacccggcgttgctcagc
gccctggatgagaggaaaaggaatgacagacaataa

DBGET integrated database retrieval system