KEGG   Oceanimonas sp. GK1: GU3_05470Help
Entry
GU3_05470         CDS       T01667                                 

Gene name
apaG
Definition
(GenBank) CO2+/MG2+ efflux protein ApaG
  KO
K06195  ApaG protein
Organism
oce  Oceanimonas sp. GK1
Brite
KEGG Orthology (KO) [BR:oce00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    GU3_05470 (apaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 DUF4354 DUF4352
Motif
Other DBs
NCBI-ProteinID: AEY00851
UniProt: H2FZ10
Position
complement(1178404..1178778)
Genome map
AA seq 124 aa AA seqDB search
MSAPAIHITPVPRYLAERSSPEDDHYVFAYTITIANQGDERVTLISRRWLITDANGKRVE
VEGSGVVGEQPTIAAGGVYTYTSGVSLETPVGVMEGFYTLRRDDGREFDAPIPAFRLALP
NLIN
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atgtccgcccccgccattcacatcaccccagtgccccgctacctggccgaacgctcttca
ccggaagacgatcactatgtgttcgcctacaccatcaccattgccaatcagggcgatgag
cgggtcaccctgatcagccgccggtggttgatcaccgatgccaatggcaaacgggtggaa
gtggaaggcagcggcgtggtgggggagcagcccaccattgccgctggaggcgtttatacc
tacaccagcggtgtcagtctggaaaccccggtgggcgtcatggaaggtttttacacgctg
cgccgggacgacggccgcgagtttgacgctcccatccccgcctttcggctggccctgccc
aacctgatcaactga

DBGET integrated database retrieval system