KEGG   Oceanimonas sp. GK1: GU3_08090Help
Entry
GU3_08090         CDS       T01667                                 

Definition
(GenBank) aromatic amino acid beta-eliminating lyase/threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
oce  Oceanimonas sp. GK1
Pathway
oce00260  Glycine, serine and threonine metabolism
oce01100  Metabolic pathways
oce01110  Biosynthesis of secondary metabolites
oce01120  Microbial metabolism in diverse environments
oce01130  Biosynthesis of antibiotics
oce01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:oce00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    GU3_08090
Enzymes [BR:oce01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     GU3_08090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 Aminotran_5 DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-ProteinID: AEY01374
UniProt: H2FTS6
Position
1762345..1763376
Genome map
AA seq 343 aa AA seqDB search
MFASDNAAGVHPAVLAALAEANRGHALGYGADDYTARANQAFKRLFGEQAESFLVFNGTG
ANVIALKGLLRSYEAVFCSAESHLWIDEAGAPEQFLGAKLITLPADNGKIRLDDMLPRLG
DIGFQHRSQPRVISIAQCTERGSVYRRDELQAICDFARRHGFYVHIDGARIHNAVAALGG
DCKRLFTDIGVDVVSFGGTKNGLMMGEAVVVLNPELQANYAVIRKHGMQLASKMRFLAAQ
FLAYFDQDLWLHNAAHANRMAACLAEQLHTVPGARLMVPAETNMLFVEIPNAWIAPLQQQ
AYFHVWRADSRPGFSEVRLVMSFDVTQADIEAFIGTMRRLATG
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgtttgccagcgacaacgccgccggagtgcatcccgcggttctggcggcgctggccgag
gccaaccggggccacgccctgggctacggggccgatgactataccgcccgggccaatcag
gccttcaagcgactctttggcgagcaggccgaaagctttctggtgtttaacggcaccggc
gccaatgtgatcgcgctcaaggggctgctgcgctcttacgaggcggtgttttgctccgcc
gagtcccacttgtggatagatgaagccggcgcccccgagcagttcctcggtgccaagctg
atcaccctgccggcagacaacggcaaaatccgcctcgacgacatgctgccccggctgggg
gacatcggttttcagcaccgcagccagcccagggtcatttccattgcccagtgcaccgag
cgcggctccgtctatcgccgggacgaactccaggcgatctgtgactttgcccgccggcac
ggcttttatgtgcatatcgacggtgcccgtattcacaatgcggtggcggcactgggcggt
gattgcaagcggctgtttaccgacatcggggtggacgtggtgtcctttggcggcaccaag
aacggcctgatgatgggggaggcggtggtggtgctcaaccccgagctgcaggcgaactac
gcggtgatccgcaagcatggcatgcagctggcgtccaaaatgcgctttcttgccgcccag
tttctggcctatttcgaccaggatctctggctgcacaatgccgcccacgccaaccgcatg
gcggcctgcctggccgagcaattgcacaccgtgcccggcgcccgtctgatggtaccggca
gaaaccaacatgctgtttgtggagatccccaatgcgtggatagcgccattgcagcaacag
gcctatttccatgtgtggcgggccgacagccggcctgggttctccgaagtccggctggtg
atgtcctttgatgttacccaggccgacatcgaggcctttatcggaacaatgcggcggctg
gccaccggctga

DBGET integrated database retrieval system