KEGG   Oceanimonas sp. GK1: GU3_09315Help
Entry
GU3_09315         CDS       T01667                                 

Gene name
sucC
Definition
(GenBank) succinyl-CoA synthetase subunit beta
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
oce  Oceanimonas sp. GK1
Pathway
oce00020  Citrate cycle (TCA cycle)
oce00640  Propanoate metabolism
oce00660  C5-Branched dibasic acid metabolism
oce01100  Metabolic pathways
oce01110  Biosynthesis of secondary metabolites
oce01120  Microbial metabolism in diverse environments
oce01130  Biosynthesis of antibiotics
oce01200  Carbon metabolism
Module
oce_M00009  Citrate cycle (TCA cycle, Krebs cycle)
oce_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:oce00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    GU3_09315 (sucC)
   00640 Propanoate metabolism
    GU3_09315 (sucC)
   00660 C5-Branched dibasic acid metabolism
    GU3_09315 (sucC)
Enzymes [BR:oce01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     GU3_09315 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A
Motif
Other DBs
NCBI-ProteinID: AEY01619
UniProt: H2FV60
Position
2024849..2026015
Genome map
AA seq 388 aa AA seqDB search
MNLHEYQAKQLFAEYGLPVSEGYACDNPQEAVEAASKIGGNMWVVKCQVHAGGRGKAGGV
KLAKSKEEIREFAEQWLGKNLVTYQTDAKGQPVAKILVESCTDIAKELYLGAVVDRGTRR
VVFMASTEGGVEIEKVAEETPELIHKAAIDPLVGPQPYQGRELAFKLGLKGDQIKQFTKI
FLGLGQMFLDYDFALLEINPLVITDAGNLHCLDGKINIDSNALYRQPKLRDMHDPSQDDA
REAHAAKWELNYVALDGNIGCMVNGAGLAMGTMDIVNLHGGKPANFLDVGGGATKERVTE
AFKIILSDSNVKAVLVNIFGGIVRCDMIAEGIIGAVKEVGVKVPVVVRLEGNNAEAGTAK
LDESGLNIIAATSLTDAAVQVVNAAQGK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaatttgcatgaatatcaggcaaaacagctgttcgccgaatacggcctgcccgtatcc
gaaggctacgcatgtgacaacccgcaggaagcggtagaagcggccagcaaaatcggcggc
aacatgtgggtggtcaaatgtcaggtccacgccggtggccgtggcaaggcaggcggtgtc
aagctggccaagagcaaggaagagatccgcgagttcgcggagcagtggctgggcaagaat
ctggtcacctaccagactgacgccaagggtcagccggtggccaagatcctggtggagtcg
tgcaccgacattgccaaggagctttacctgggcgcggtcgtggaccggggtacccgtcgt
gtggtgttcatggcatcaaccgaaggcggcgtggaaattgagaaggtggccgaagagacc
cccgaactgatccacaaggccgccatcgatcccctggtgggcccgcagccttatcagggc
cgtgagctggcattcaaactgggcctgaaaggcgaccagatcaagcagttcaccaaaatc
ttcctcggtctgggacagatgttcctggactacgatttcgccctgctcgaaatcaacccc
ctggtgatcaccgatgccggcaacctgcactgcctggacggcaagatcaacatcgactcc
aacgccctgtaccgtcagcccaagctgcgcgacatgcatgacccaagccaggacgatgcc
cgtgaagcccacgcggccaagtgggagctgaactatgtggcgctggatggcaacatcggc
tgcatggtgaacggggccggtctggccatgggcaccatggacatcgtgaacctgcacggc
ggcaagccggccaacttcctggatgtgggcggtggcgccaccaaggaacgggtgaccgag
gcgttcaagattattctctccgacagcaatgtgaaagcggtactggtgaacatctttggc
ggtattgtccgttgcgacatgattgccgaaggcatcatcggtgcggtgaaggaagtgggt
gtcaaagtcccggtggtggtccgtctggaaggcaataatgccgaagccggtaccgccaag
ctggacgagtccggcctcaacatcatcgccgccaccagcctgaccgacgccgccgttcag
gtcgttaacgccgcacaggggaaataa

DBGET integrated database retrieval system