KEGG   Oceanimonas sp. GK1: GU3_11250Help
Entry
GU3_11250         CDS       T01667                                 

Definition
(GenBank) putative acyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
oce  Oceanimonas sp. GK1
Pathway
oce00071  Fatty acid degradation
oce00072  Synthesis and degradation of ketone bodies
oce00280  Valine, leucine and isoleucine degradation
oce00310  Lysine degradation
oce00362  Benzoate degradation
oce00380  Tryptophan metabolism
oce00620  Pyruvate metabolism
oce00630  Glyoxylate and dicarboxylate metabolism
oce00640  Propanoate metabolism
oce00650  Butanoate metabolism
oce00900  Terpenoid backbone biosynthesis
oce01100  Metabolic pathways
oce01110  Biosynthesis of secondary metabolites
oce01120  Microbial metabolism in diverse environments
oce01130  Biosynthesis of antibiotics
oce01200  Carbon metabolism
oce01212  Fatty acid metabolism
oce02020  Two-component system
Brite
KEGG Orthology (KO) [BR:oce00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    GU3_11250
   00630 Glyoxylate and dicarboxylate metabolism
    GU3_11250
   00640 Propanoate metabolism
    GU3_11250
   00650 Butanoate metabolism
    GU3_11250
  09103 Lipid metabolism
   00071 Fatty acid degradation
    GU3_11250
   00072 Synthesis and degradation of ketone bodies
    GU3_11250
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    GU3_11250
   00310 Lysine degradation
    GU3_11250
   00380 Tryptophan metabolism
    GU3_11250
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    GU3_11250
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    GU3_11250
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    GU3_11250
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:oce04147]
    GU3_11250
Enzymes [BR:oce01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     GU3_11250
Exosome [BR:oce04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   GU3_11250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C SpoVAD ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AEY02005
UniProt: H2FWM3
Position
complement(2441387..2442598)
Genome map
AA seq 403 aa AA seqDB search
MSEPVYIVAAKRTPIGAFLGSLKTVAPADLAAAAIKGALEQAKLSGKDVNEVIVGNVISA
GQGMGIGRQAALAAGIPAGIPAYTLNMVCGSGMKTLMDACAHIKAGDAEVVVAAGCENMS
QIPHVVKGDLRNGQKMGDMTLSDLLLSDGLTDVFNQYHMGVTAENVVAQENISREEQDAL
AVASQSKAVAAIEAGFFKDEIVPVEVSSRKEVLTIDTDEYPKAGTTTEALAKLRPAFKRE
GGSVTAGNASGINDGGSAIIVASKSAVERLGLTPLAEVVSYGQGGIDPAIMGLGPVPAIA
QALDKAGLKLADIERFELNEAFAGQALGVVRQLSNQHGIAEQALLEKTNKNGGAIALGHP
LGASGNRIMVTLLYELQRSNANLGLASLCVGGGMGTAVILKRV
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaacctgtatacattgttgcagctaaacgcacccccattggcgcctttctgggc
tcgctgaaaaccgttgctcccgccgatctggcagccgccgccattaaaggcgccctagag
caggccaaactgtccggcaaggatgtgaacgaagtgatcgtcggcaacgtgatcagcgcc
ggccagggcatgggcattggccgccaggccgcgctggccgcgggcattcccgccggcatt
cccgcctataccctgaacatggtgtgcggcagcggcatgaaaaccctgatggacgcctgc
gcccacatcaaggccggtgacgccgaggtggtggtggccgcgggctgtgaaaacatgtcg
caaattccccatgtggtgaaaggcgatttgcgcaacggccagaagatgggcgacatgacc
ctgtccgacctgctgctgagtgacggcctgaccgacgtgttcaaccagtaccacatgggc
gtgaccgccgaaaacgtggtggcccaggaaaacatcagccgtgaagagcaggatgccctg
gccgtggccagccagagcaaggcggtggccgccattgaggccggcttcttcaaggacgaa
atcgtgccggtggaagtgagctcccgcaaggaagtgctgaccattgacaccgacgaatat
cccaaggctggcaccaccaccgaggccctggccaagctgcgtccggcgttcaagcgtgag
ggtggctcggtgactgcgggtaacgcgtccggcatcaacgacggcggcagcgctatcatt
gtggccagcaagtccgccgtggagcggctgggcctgactcccctggccgaggtggtgagc
tatggtcagggcggcatcgatccggcaatcatgggactgggcccggtgcccgccattgcc
caggcgctggacaaggccggtctgaaactggccgatatcgagcgtttcgagcttaacgaa
gcctttgccggccaggcgctgggtgtggtacgccagctgtcgaaccagcatggcatcgcc
gagcaggcgctgctggaaaaaaccaacaagaacggcggtgccattgccctgggtcatcct
ctgggtgcgtccggcaaccgcatcatggtaactctgctgtatgaactgcagcgcagcaac
gccaaccttggcctggcctccctgtgtgtgggcggcggtatgggcacggcggtcatcctc
aagcgggtgtaa

DBGET integrated database retrieval system