KEGG   Oceanimonas sp. GK1: GU3_14500Help
Entry
GU3_14500         CDS       T01667                                 

Definition
(GenBank) pterin-4-alpha-carbinolamine dehydratase
  KO
K01724  4a-hydroxytetrahydrobiopterin dehydratase [EC:4.2.1.96]
Organism
oce  Oceanimonas sp. GK1
Pathway
oce00790  Folate biosynthesis
oce01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:oce00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    GU3_14500
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:oce04147]
    GU3_14500
Enzymes [BR:oce01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.96  4a-hydroxytetrahydrobiopterin dehydratase
     GU3_14500
Exosome [BR:oce04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   GU3_14500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_4a
Motif
Other DBs
NCBI-ProteinID: AEY02653
UniProt: H2FU26
Position
3151978..3152319
Genome map
AA seq 113 aa AA seqDB search
MTHLAQQQCEACRADAPKVSDTELAELMKQIPDWTPQARDGVLQLEREFTFKNFKLAWAF
ADKVATLAESEFHHPAILLEWGKVTVTWWTHAIGGLHRNDFIMAARTDRLLDE
NT seq 342 nt NT seq  +upstreamnt  +downstreamnt
atgacccacctggcccaacaacagtgcgaggcctgccgggccgacgcgcccaaagtcagc
gataccgagctggccgagctgatgaagcaaattcccgactggaccccccaggcccgggac
ggcgtgctgcagctggagcgggagttcacattcaaaaacttcaagctggcctgggccttt
gccgacaaggtcgcaacgcttgccgaaagcgagtttcaccacccggccattttgctggaa
tggggcaaggtcaccgtcacctggtggacccacgccatcggtggcctgcaccgcaacgac
ttcattatggcggcccggacggaccggctgctggacgagtga

DBGET integrated database retrieval system