KEGG   Oceanimonas sp. GK1: GU3_15050Help
Entry
GU3_15050         CDS       T01667                                 

Definition
(GenBank) oxaloacetate decarboxylase
  KO
K01571  oxaloacetate decarboxylase (Na+ extruding) subunit alpha [EC:7.2.4.2]
Organism
oce  Oceanimonas sp. GK1
Pathway
oce00620  Pyruvate metabolism
oce01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:oce00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    GU3_15050
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:oce02000]
    GU3_15050
Enzymes [BR:oce01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.4  Linked to decarboxylation
    7.2.4.2  oxaloacetate decarboxylase (Na+ extruding)
     GU3_15050
Transporters [BR:oce02000]
 Other transporters
  Primary active transporters [TC:3]
   GU3_15050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PYC_OADA HMGL-like Biotin_lipoyl Biotin_lipoyl_2 HlyD_3 PTS_EIIA_1 GCV_H Peptidase_M23
Motif
Other DBs
NCBI-ProteinID: AEY02763
UniProt: H2FUU5
Position
complement(3283442..3285241)
Genome map
AA seq 599 aa AA seqDB search
MTQPLAITDVVLRDAHQSLLATRLRLEDMLPIAEKLDAIGYWSLETWGGATFDACIRYLG
EDPWERLRALKKAMPNTRQQMLLRGQNLLGYRHYADDLVFKFVERARANGMDVFRIFDAM
NDVRNLQSAIKATVEMEGHAQGTISYTTSKVHTLETWVDMAKRLQDLGCHSICIKDMSGL
LKPYEAETLIKRIKAEVSLPLALHCHATTGLSLPTHMKAIDAGIDILDTAISSMSMTYGH
SPTETLVAMVQGSERDTGLDLTKLEEIAAYFREVRKKYAKFEGSLKGVDSRILLAQVPGG
MLTNMESQLKEQGAADRMDEVLEEIPRVREDLGFIPLVTPTSQIVGTQAVINVLTGERYK
TITKETAGILKGEYGAAPAPLNAELQARVLNGAEPISCRPADLLSDELERLTSEFQALAK
EEQLRVASAEVDDVLTYALFPQIGLKFLRNRDNPDAFEPAPGSEPVPAAPAASAPAGAPA
GAPETYAVKVDGQVFEVEVGPAGSISAVRETGAAAATPAPAPAVAPAGSGEPVAAPLAGN
IFKILAKKGASVAAGEVLLIMEAMKMETEVRAARDGQIVDVLVKEGDAVSVGDTLVSLG
NT seq 1800 nt NT seq  +upstreamnt  +downstreamnt
atgactcaacccctcgccattaccgacgtggtgctgcgtgacgcgcaccaatccctgctg
gccacccgcctgcgtctggaagacatgctgcccattgccgaaaagctcgatgccatcggc
tactggtcactggaaacctggggcggcgccacctttgacgcctgcattcgctacctgggc
gaagatccctgggagcggctgcgcgccctgaaaaaagccatgcccaacactcgccagcaa
atgctgctgcgcggccagaacctgctgggctaccgccattacgccgatgatctggtattc
aagttcgtggagcgggcccgggccaacggtatggacgtgttccgcatcttcgatgccatg
aacgacgtgcgcaacctgcaaagtgccatcaaggccacggtggaaatggaggggcatgcc
cagggcaccatctcctacaccacctccaaggtgcataccctggagacctgggtcgacatg
gccaagcggctgcaggatctgggctgtcactctatctgtatcaaggacatgtcgggcctg
ctcaagccctatgaggcggagaccctgatcaagcgcatcaaggccgaagtgtcgctgcca
ttggcgctgcattgtcatgccaccaccggcctcagcctgccgacccacatgaaggccatc
gatgccggcatcgatatcctcgacaccgccatttcctccatgagcatgacctacggccat
tctcccaccgaaaccctggtggccatggtgcagggcagcgaacgcgataccggcctggat
ctgaccaagctggaagagatcgccgcctatttccgtgaggtgcgcaagaagtacgccaaa
tttgaaggtagcctcaagggcgtcgactcccgcattctgctggctcaggtgcccggtggc
atgctcaccaacatggaaagccagctgaaagagcagggcgccgccgatcgcatggacgag
gtgctggaagagatcccccgggtgcgggaagatctgggctttattccgctggtgaccccg
acctcccagattgtgggtacccaggcggtgatcaacgtgctcaccggcgagcggtacaag
accatcaccaaggagaccgccggtattctcaagggcgagtatggtgccgcgccggcgccg
ctcaatgccgagctgcaggcgcgggtgctgaacggtgccgagcccatcagctgccgcccg
gcggatctgctctccgacgagctggagcgcctcaccagtgagttccaggccctggcgaag
gaagaacaactgcgggtggccagcgctgaagtggacgatgtgctcacctacgccctgttc
ccgcagatcggcctcaaattcctgcgtaaccgggacaatccggacgcctttgagccggcc
ccgggcagcgagccggtgcctgccgctccggccgcttctgctcctgccggcgcccctgca
ggcgcccccgagacctatgcggtcaaggtggatggccaggtgtttgaagtggaagtgggc
ccggcgggcagcatcagtgccgtgcgtgaaaccggcgccgctgccgcgacacccgccccg
gccccggccgtggcccccgccggcagcggtgagccggtcgcggcgccactggcgggcaac
atcttcaagatcctggccaaaaagggcgcgtcggtggccgccggcgaggtactgctgatc
atggaagccatgaagatggaaaccgaggtgcgcgccgcccgggacggccagattgtggac
gtgctggtgaaggaaggcgacgccgtgtccgtgggcgataccctggtcagcctgggctga

DBGET integrated database retrieval system