KEGG   Oceanimonas sp. GK1: GU3_15200Help
Entry
GU3_15200         CDS       T01667                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
oce  Oceanimonas sp. GK1
Pathway
oce00071  Fatty acid degradation
oce00072  Synthesis and degradation of ketone bodies
oce00280  Valine, leucine and isoleucine degradation
oce00310  Lysine degradation
oce00362  Benzoate degradation
oce00380  Tryptophan metabolism
oce00620  Pyruvate metabolism
oce00630  Glyoxylate and dicarboxylate metabolism
oce00640  Propanoate metabolism
oce00650  Butanoate metabolism
oce00900  Terpenoid backbone biosynthesis
oce01100  Metabolic pathways
oce01110  Biosynthesis of secondary metabolites
oce01120  Microbial metabolism in diverse environments
oce01130  Biosynthesis of antibiotics
oce01200  Carbon metabolism
oce01212  Fatty acid metabolism
oce02020  Two-component system
Brite
KEGG Orthology (KO) [BR:oce00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    GU3_15200
   00630 Glyoxylate and dicarboxylate metabolism
    GU3_15200
   00640 Propanoate metabolism
    GU3_15200
   00650 Butanoate metabolism
    GU3_15200
  09103 Lipid metabolism
   00071 Fatty acid degradation
    GU3_15200
   00072 Synthesis and degradation of ketone bodies
    GU3_15200
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    GU3_15200
   00310 Lysine degradation
    GU3_15200
   00380 Tryptophan metabolism
    GU3_15200
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    GU3_15200
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    GU3_15200
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    GU3_15200
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:oce04147]
    GU3_15200
Enzymes [BR:oce01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     GU3_15200
Exosome [BR:oce04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   GU3_15200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AEY02793
UniProt: H2FUX5
Position
complement(3316163..3317350)
Genome map
AA seq 395 aa AA seqDB search
MNTERQIVIVAAARTPMGGLMGSLGSEPAHRLGAVAIHAALARGGIGGEQVDEVIMGCVL
PAGQGQAPARQAALGAGLPVSVPCTTVNKMCGSGMKALMLAHDQLRAGSASLMVAGGMES
MSLAPYLVPRARVGLRLGHGQLLDHMFLDGLEDAYEGGLMGCFAQRTADRFGVTRAEMDD
FAIRSLRRAQRAIDEGDFREEIAPVTVTGRKGEIMVDTDEQPGKASPEKIPRLNPAFADN
GTITAANSSSISDGAAALVLTTAERAQQLGLRPLARVLGHATHAQLPAEFTLAPIGAMQT
LLKQLDWQADEVDLFEINEAFAVVTLLAIRELGLDPDSVNVNGGACALGHPIGASGARIV
VTLLHALRRRGLKKGVAALCIGGGEATALAIELCE
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgaacacagagcgccagattgtgattgtggccgccgcccgcacccccatgggcgggctg
atgggctcactgggcagtgaacccgcccaccggctgggggcggtggccatccatgccgcc
ctggcgcggggcggtattggcggggagcaggtggatgaggtgatcatgggttgtgtgctg
cctgccggccaggggcaggctccggcccggcaggcggccctgggcgcggggctgccggta
tcggtgccctgcaccacggtcaacaaaatgtgcggctcgggcatgaaggcgctgatgctg
gctcacgaccaactgcgggcgggctcggcctcgctgatggtggccggcggcatggaaagc
atgagcctggccccctacctggtgcccagggcccgggtcggcttgcggctgggtcacggt
cagttattggatcatatgtttctcgacggcttggaagacgcctatgaaggcggcctgatg
ggttgctttgcccagcgtaccgccgaccgctttggcgtgacccgcgccgaaatggacgac
tttgccatccgttcgttgcgccgggcccagcgggccattgatgaaggggactttcgcgag
gaaatcgccccggtcacggtgaccggccgcaaaggcgagatcatggtggacaccgacgag
cagccgggcaaggcaagccctgaaaaaattccgcgcctcaaccccgcctttgccgacaac
ggcaccattaccgccgccaattccagctccatttccgacggtgccgccgccctggtgctg
accacggcggaaagggcacaacagcttggcctcaggccgctggcgcgcgttcttggtcac
gccactcatgcgcaattgcccgccgaatttaccctggcgcccatcggtgccatgcagaca
ttgctgaaacaactggattggcaagcggacgaggtggatttattcgagatcaacgaagcc
tttgcggtggtcaccctgctggccatcagggaactggggcttgacccggacagcgtgaac
gtaaacggcggcgcctgtgccctggggcatcccatcggtgccagcggcgcgcgcattgtg
gtgaccctgctgcatgccctgcgccggcgagggctgaagaaaggagtggcggccctgtgc
atcggcgggggcgaagccacggcgctggccattgaactgtgtgagtga

DBGET integrated database retrieval system