KEGG   Oligotropha carboxidovorans OM5 (Goettingen): OCA5_c00560Help
Entry
OCA5_c00560       CDS       T01617                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase alpha chain TrpA
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
ocg  Oligotropha carboxidovorans OM5 (Goettingen)
Pathway
ocg00260  Glycine, serine and threonine metabolism
ocg00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ocg01100  Metabolic pathways
ocg01110  Biosynthesis of secondary metabolites
ocg01130  Biosynthesis of antibiotics
ocg01230  Biosynthesis of amino acids
Module
ocg_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ocg00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    OCA5_c00560 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    OCA5_c00560 (trpA)
Enzymes [BR:ocg01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     OCA5_c00560 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth PcrB
Motif
Other DBs
NCBI-ProteinID: AEI04790
UniProt: B6JCP3
Position
complement(66027..66863)
Genome map
AA seq 278 aa AA seqDB search
MTTRLDTRFADLKKEGRAALVTFLMCGDPDLETSLAIMKALPKAGADVIEIGMPFTDPMA
DGPAIQAAGLRALKAGTTLKKTLDVVRNFRKGEAATPVVLMGYYNPIFIYGVDRFLVDAK
EAGVDGLIVVDLPPEEDEELCLPALKAGVNFIRLATPTTDDKRLPAVLANTSGFVYYVSI
TGITGAAAADDKQVGEAVARIKRHTQLPVCVGFGIRTPEAAARIARHCEGAVVGSALVDA
LRGTLDAEGKAGPNTVSAVTDLVAALAQGVHGVKPVSA
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgaccacgcgcctcgatacccgcttcgccgatctcaagaaggaaggccgcgccgcgctc
gtcaccttcctgatgtgcggcgatcccgatcttgaaacctcgctcgcgatcatgaaggcg
ctgccgaaggcgggcgccgatgtgatcgagatcggcatgccgttcaccgacccgatggcg
gatgggcctgcgattcaggcggcagggctgcgcgcgctgaaggccggcaccacgctgaag
aagacgctcgatgtcgtgcgcaacttccgcaagggtgaagcggcaacgcccgtcgtgctg
atgggctactacaatccgatcttcatctacggtgtcgatcgcttcctcgtcgatgcgaag
gaggcgggcgtcgatgggctcattgtcgtggacttgccgccggaggaagacgaggagctg
tgcctgcccgcgctcaaggccggtgtgaacttcatccggcttgcgacgccgacgaccgac
gacaagcggctgccggccgtgctcgccaacacgtcgggctttgtctattacgtctcgatc
accggcatcaccggcgccgccgcagccgacgacaagcaggtcggcgaagcggtggcgcgg
atcaagcgtcacacccaattgccggtctgcgtcggcttcggcattcgcacgcccgaggcg
gcggcccgcatcgcacgccattgcgagggcgccgtcgtcggctctgcgcttgtcgatgcg
ctgcgcggaacgctcgacgccgagggcaaggccgggccgaacacggtatccgccgtcacc
gacctggtcgctgcgctggcacagggcgtccatggcgtcaaaccagtgtcggcgtaa

DBGET integrated database retrieval system