KEGG   Oligotropha carboxidovorans OM5 (Goettingen): OCA5_c03290Help
Entry
OCA5_c03290       CDS       T01617                                 

Gene name
trbG1
Definition
(GenBank) conjugal transfer protein TrbG
  KO
K20532  type IV secretion system protein TrbG
Organism
ocg  Oligotropha carboxidovorans OM5 (Goettingen)
Pathway
ocg02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:ocg00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    OCA5_c03290 (trbG1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ocg02044]
    OCA5_c03290 (trbG1)
Secretion system [BR:ocg02044]
 Type IV secretion system
  Trb secretion system protein
   OCA5_c03290 (trbG1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CagX
Motif
Other DBs
NCBI-ProteinID: AEI05058
UniProt: B6JA67
Position
337186..338169
Genome map
AA seq 327 aa AA seqDB search
MNPSFRRSAFPVFRKSAFAAALLSATVLAGCATAPKPPQISYDSTVPPLPSVPAVITDQR
PRPLHTPPAWIPARGGNSASTPTARVENANAAARVEPRRDGYYNSIQIYPWSEGALYQVY
AAPGQITNIALEPGENLTGAGPIAAGDTARWIIGDTESGSGVTRRVHVLVKPTRTDITTN
LVITTDRRVYMIELRAGTNPYMPAVAWAYPEPPASQRANVPARPVVPAATARNYRYGLMG
DTPPWRPVSVYDDGRRVYVEFPRGIVQGEMPPIFVIGSDGEPQIVNSRIYQNILIVDRIF
GAAELRLGGGDRQQTVRIVRTDGRPAS
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgaacccgtctttccgcaggtccgcgtttcctgttttccgtaaatccgcctttgcggct
gccctgctgtccgcaaccgtcctcgccggttgcgccaccgcgccgaaaccgccgcagatc
agctacgatagcactgttccaccacttccgtcggtcccggcagtcatcacggatcagcgg
ccacgtccgctgcatacgcctccggcctggatcccggcccggggcggcaattccgcgagc
acgccgaccgcgcgcgtcgagaacgccaacgccgccgcgcgtgtcgagccgcggcgagac
ggctattacaactccatccagatctatccctggagtgaaggggccctctatcaggtctat
gccgcgcccgggcagatcacgaatatcgcgcttgagccgggcgaaaacctgaccggagca
ggtccgatcgccgccggtgacacggccaggtggattatcggcgacaccgaaagcggctcg
ggcgtgacccgccgcgtccatgtgctcgtgaagccgaccaggaccgacatcacgaccaat
ctcgtcatcacgaccgatcggcgcgtctacatgatcgaactgcgcgcgggcacgaacccc
tatatgcccgccgtggcatgggcctatcccgagcccccagccagccaacgcgccaacgtc
ccggcgaggcccgtcgttcctgccgcgactgcgcgcaactatcgctatggcctgatgggc
gatacgcccccatggcgtccggtctcggtctatgacgatgggcggcgcgtctacgtcgaa
ttcccgcgcggcatcgtccagggcgagatgccgccgatcttcgtcatcggctccgacggc
gagccgcaaatcgtcaacagccgcatctaccagaacatcctgatcgtcgatcgcatcttt
ggtgcagccgaactgcgtctcggaggcggcgatcgtcagcagaccgtcaggatcgtccgt
actgacgggaggcccgcatcatga

DBGET integrated database retrieval system