KEGG   Oligotropha carboxidovorans OM5 (Goettingen): OCA5_c04030Help
Entry
OCA5_c04030       CDS       T01617                                 

Gene name
phbA
Definition
(GenBank) acetyl-CoA acetyltransferase PhbA
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ocg  Oligotropha carboxidovorans OM5 (Goettingen)
Pathway
ocg00071  Fatty acid degradation
ocg00072  Synthesis and degradation of ketone bodies
ocg00280  Valine, leucine and isoleucine degradation
ocg00310  Lysine degradation
ocg00362  Benzoate degradation
ocg00380  Tryptophan metabolism
ocg00620  Pyruvate metabolism
ocg00630  Glyoxylate and dicarboxylate metabolism
ocg00640  Propanoate metabolism
ocg00650  Butanoate metabolism
ocg00900  Terpenoid backbone biosynthesis
ocg01100  Metabolic pathways
ocg01110  Biosynthesis of secondary metabolites
ocg01120  Microbial metabolism in diverse environments
ocg01130  Biosynthesis of antibiotics
ocg01200  Carbon metabolism
ocg01212  Fatty acid metabolism
ocg02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ocg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    OCA5_c04030 (phbA)
   00630 Glyoxylate and dicarboxylate metabolism
    OCA5_c04030 (phbA)
   00640 Propanoate metabolism
    OCA5_c04030 (phbA)
   00650 Butanoate metabolism
    OCA5_c04030 (phbA)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    OCA5_c04030 (phbA)
   00072 Synthesis and degradation of ketone bodies
    OCA5_c04030 (phbA)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    OCA5_c04030 (phbA)
   00310 Lysine degradation
    OCA5_c04030 (phbA)
   00380 Tryptophan metabolism
    OCA5_c04030 (phbA)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    OCA5_c04030 (phbA)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    OCA5_c04030 (phbA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    OCA5_c04030 (phbA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ocg04147]
    OCA5_c04030 (phbA)
Enzymes [BR:ocg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     OCA5_c04030 (phbA)
Exosome [BR:ocg04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   OCA5_c04030 (phbA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AEI05128
UniProt: B6JA15
Position
420250..421428
Genome map
AA seq 392 aa AA seqDB search
MSDDVVIVSAARTPVGSFNGAFATVPAHELGAVAIKGALERAGVDPSQVSEVIMGQILTA
GQGQNPARQASIRAGIPVGSPAWGINQLCGSGLRAVALGYQALKNGDSEIAVAGGQESMS
MAPHAQYLRGGVKMGNTELIDTMIKDGLWDAFNGYHMGTTAENVAKQYQITRQQQDEFAV
SSQQKAEAAQKAGRFKDEIVPFIVKSRKGEITVDTDEYPRHGATLEAMAKLRPAFEKEGS
VTAGNASGINDGAAALVLMTASRAAKEGKTPLARIVSWAQAGVDPSIMGTGPIPSSRRAL
QKAGWKIEDLDLIEANEAFAAQACAVNKDLGWDTSKVNVNGGAIAIGHPVGASGARVLTT
LLFEMQKRDSKKGLATLCIGGGMGIAMCVERD
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgtcagacgatgtcgtcatcgtcagcgccgcccgtactccggttggctcgttcaacggt
gcgtttgccactgtgccggcgcatgaactcggcgctgtcgcaatcaagggtgctctcgag
cgcgcgggcgtcgacccctcgcaggtctcagaagtcatcatgggtcagattctcacggcg
gggcagggtcagaatccggcgcgtcaggcgtcgatcagggctggcattccggtcggaagc
ccggcctggggcatcaaccagctctgcggctcaggcttgcgggcggtcgcgctcggctat
caggcgttgaagaacggcgattccgaaattgccgtcgccggtggccaggaatccatgagc
atggccccgcatgcgcagtatctgcgcggtggcgtgaagatgggcaacaccgaactgatc
gacaccatgatcaaggatggactgtgggatgcctttaacggctatcacatgggtaccacc
gccgagaacgtcgccaagcaatatcagatcacccgccagcagcaggatgaattcgccgtc
tcctctcagcagaaggcggaagcggcgcagaaagccggccggttcaaggacgagatcgtg
ccgttcatcgtcaagtcgcgcaagggcgagatcaccgtcgacaccgacgaatatccgcgc
cacggcgcgacccttgaggcgatggcgaagctgcgcccggccttcgagaaggaaggctcc
gtcaccgcaggcaatgcgtcgggcatcaatgacggcgcggccgctcttgtcctgatgacg
gcatcgcgggcggcgaaggaaggcaagaccccgcttgcccgcatcgtctcctgggcgcag
gccggcgtcgatccttcgatcatgggcaccgggccgatcccgtcctcgcgccgtgcgctg
cagaaagccggctggaagatcgaggacctcgacctcatcgaggcgaacgaggcgtttgcc
gcacaggcctgcgcggtcaacaaggatctcggctgggatacctcgaaggtcaacgtcaat
ggcggcgccatcgcgatcggccacccggtcggtgcatccggtgcgcgcgtactgacgacc
ttgctgttcgagatgcagaagcgcgattccaagaaagggctcgcgacactttgcatcggc
ggcggcatgggcattgccatgtgcgtggagcgcgactga

DBGET integrated database retrieval system