KEGG   Oligotropha carboxidovorans OM5 (Goettingen): OCA5_c09080Help
Entry
OCA5_c09080       CDS       T01617                                 

Definition
(GenBank) response regulator, two-component system sensor histidine kinase
  KO
K07659  two-component system, OmpR family, phosphate regulon response regulator OmpR
Organism
ocg  Oligotropha carboxidovorans OM5 (Goettingen)
Pathway
ocg02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ocg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    OCA5_c09080
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:ocg02022]
    OCA5_c09080
Two-component system [BR:ocg02022]
 OmpR family
  EnvZ-OmpR (osmotic stress response)
   OCA5_c09080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C MOSC
Motif
Other DBs
NCBI-ProteinID: AEI05630
UniProt: B6JIR2
Position
965373..966098
Genome map
AA seq 241 aa AA seqDB search
MNEAAAGERKPRRIDDEAPHLLLVDDDRRIRDLLSRFLGNEGYRVTTARSAAAARAKLTG
LDFDLLILDVMMPGETGFELARALRETSQVPIIMLTARHEAESRIEGLQIGADDYVAKPF
EPRELLLRIANILKRVAPIAVMPVESVAFGPYVYHLERGELRNGDEVIHLTDREREMLRI
LASAPGETVSRAMLTGNGNNGNERAVDVQINRLRRKIERDPANPLFLQAVRGIGYRLVAS
P
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
gtgaacgaggcagcggccggcgagagaaagccaagacggatcgacgacgaggcgccgcat
ctgttgctcgtcgacgatgaccgccgcattcgcgatctgctttcgcgctttctcggcaat
gaaggctaccgcgtcaccaccgcgcggagtgctgctgcggcgcgcgccaagctgaccggc
cttgatttcgatctcctgattctcgatgtgatgatgccaggcgaaaccggcttcgagctg
gcacgggcgttgcgtgaaacctcgcaagtgccgatcatcatgctgactgcgcgccatgag
gcggaaagcaggatcgagggtctgcagattggtgccgacgattacgtcgcaaagcccttc
gagccgcgcgagctgttgctgcggatcgccaacatcctgaagcgtgtggcgccgatcgcg
gtgatgccggtggagtcggtggcgttcgggccttacgtctatcatctcgagcgcggcgaa
ctgcgcaacggcgatgaggtgatccacctgaccgaccgcgaacgcgagatgctgcgcatt
cttgcgtctgcgccgggcgagacggtgtcgcgcgcaatgctgaccggcaacggcaataac
ggcaacgagcgggcggtcgacgtgcagatcaaccgcctgcgccgcaagatcgagcgcgat
cccgccaatccgctgttcctgcaggcggtgcgtggcatcggctatcgactggttgcctcg
ccatga

DBGET integrated database retrieval system