KEGG   Oligotropha carboxidovorans OM5 (Goettingen): OCA5_c11280Help
Entry
OCA5_c11280       CDS       T01617                                 

Gene name
ispE
Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase IspE
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
ocg  Oligotropha carboxidovorans OM5 (Goettingen)
Pathway
ocg00900  Terpenoid backbone biosynthesis
ocg01100  Metabolic pathways
ocg01110  Biosynthesis of secondary metabolites
ocg01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ocg00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    OCA5_c11280 (ispE)
Enzymes [BR:ocg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     OCA5_c11280 (ispE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-ProteinID: AEI05847
UniProt: F8BU95
Position
1207020..1207904
Genome map
AA seq 294 aa AA seqDB search
MGELTDIARAKVNLTLRVLGRRPDGYHDLYSIVAFADCADRLTLDPHRDLGLTVTGPGAA
VCGEGDDNLVIRAARHLAERVPGLRLGHFTLDKHLPVAAGIGGGSADAAAALRLLAKING
LATDDPRLVETARATGADVPVCVPSHACVMSGVGENLTILDLPPLACVLVNPRVAVATKD
VFAGLGLRAGELRVGVGEMIEAVTLPKDGASASDWITQLAMGVNHLEAPALRVEPVIGEV
LAALRAHEGVRFARMSGSGATCFAVYDDVATAKEIAGHVAQAHPQWWVHAGVLS
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgggtgagctgaccgatatcgcgcgggccaaggtcaatttgacgctgcgtgtgttgggc
cgccgcccggacggctatcacgatctctacagcatcgttgcgttcgccgattgcgcagat
cgcctgacgctcgatccgcatcgcgatctcggcctcactgtcaccggccccggcgccgct
gtctgtggcgagggcgacgataacctcgtcatccgtgctgcgcgtcatctcgccgaacgc
gtgccgggcttgcggctcggccacttcacgctcgacaagcatctgccggtggcggcgggc
atcggtggcggctcggccgacgccgcggcggcgctgcggctgctggcaaagatcaacggc
ctcgcaaccgatgatccgcggctggtcgagacggcacgtgcgaccggtgccgacgtgccg
gtgtgcgtgccctcgcatgcctgcgtgatgagcggggtcggcgaaaatctgacgatactc
gatctgccgccgctcgcgtgcgttctggtcaatccgcgggttgcggtggcgaccaaggac
gtcttcgcggggcttgggcttcgtgccggcgagttgcgggtcggcgtcggcgagatgatc
gaggcggtgacgctgcccaaggatggagcctcggctagtgattggatcacgcagcttgcg
atgggcgtcaaccatctggaagcgccggcgctacgcgtcgagccggtgatcggcgaggtt
ctggctgcgctgcgcgcacacgagggtgtgcggtttgcgcggatgtcgggctcgggggcg
acttgttttgcagtctatgatgacgttgcgaccgcgaaagagatcgcaggtcatgtcgcg
caggcccatccgcaatggtgggtccacgccggggtgttgagctag

DBGET integrated database retrieval system