KEGG   Oligotropha carboxidovorans OM5 (Goettingen): OCA5_c12650Help
Entry
OCA5_c12650       CDS       T01617                                 

Definition
(GenBank) ThiJ/PfpI domain-containing protein
  KO
K18199  cyclohexyl-isocyanide hydratase [EC:4.2.1.103]
Organism
ocg  Oligotropha carboxidovorans OM5 (Goettingen)
Pathway
ocg00930  Caprolactam degradation
Brite
KEGG Orthology (KO) [BR:ocg00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    OCA5_c12650
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:ocg01002]
    OCA5_c12650
Enzymes [BR:ocg01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.103  cyclohexyl-isocyanide hydratase
     OCA5_c12650
Peptidases [BR:ocg01002]
 Cysteine Peptidases
  Family C56: PfpI endopeptidase family
   OCA5_c12650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DJ-1_PfpI DUF2069
Motif
Other DBs
NCBI-ProteinID: AEI05981
UniProt: B6JHB2
Position
1354209..1354913
Genome map
AA seq 234 aa AA seqDB search
MLPPDKHLTIGSMLFPGLDQIDLTGPFEVLSAIPNSTLHVVGKTKSPVKDFHGLNLVADM
TYDEAPDLDVLHVPGGPGQQALMEDEETLNFIRKQASKATYVFSVCTGALLCGAAGLIKG
KRATTHWASHHLLPYFGATPVDQRVVIDGNWVFAAGVTSGIDGALHVAALLRGQPAAEQI
QLYMQYQPEPPFDAGTPDRAPKQVLENARNAVSKLTADRLATAKKISAQLGIKV
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgcttccaccggacaagcacctcacgatcggatcgatgctgtttccaggtctcgaccag
atcgatcttaccggcccctttgaggttctgtcggctattcccaattcgacgctgcatgtc
gtcgggaagaccaagagcccggttaaggactttcacgggctgaacctcgttgccgatatg
acctacgacgaggctcccgatctggacgttctgcacgtgccgggcggcccggggcaacag
gcattgatggaagatgaggagactctcaacttcatccgcaagcaggcatcaaaggcgacg
tatgtattttccgtctgcacgggcgccttgctttgcggtgctgccggcttgatcaaaggc
aaaagggcgacaacgcattgggcgtctcaccatctcctgccgtacttcggcgcgacgccg
gtggaccagcgtgttgtgattgacggcaactgggtcttcgctgccggcgtgacgtccgga
attgatggtgcgttgcatgtggccgctttgctgcgcggccagcctgcggcggagcaaatt
cagctttacatgcagtatcagcctgaaccgccgttcgatgcagggactccggatcgtgcc
cccaagcaggtgttggagaacgcgcgcaatgcggtcagcaagctgacagcggatcgcctt
gcgaccgcaaagaagatttccgcgcagcttggtattaaggtctag

DBGET integrated database retrieval system