KEGG   Oligotropha carboxidovorans OM5 (Goettingen): OCA5_c13350Help
Entry
OCA5_c13350       CDS       T01617                                 

Gene name
sucC1
Definition
(GenBank) succinyl-CoA ligase [ADP-forming] subunit beta
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
ocg  Oligotropha carboxidovorans OM5 (Goettingen)
Pathway
ocg00020  Citrate cycle (TCA cycle)
ocg00640  Propanoate metabolism
ocg00660  C5-Branched dibasic acid metabolism
ocg01100  Metabolic pathways
ocg01110  Biosynthesis of secondary metabolites
ocg01120  Microbial metabolism in diverse environments
ocg01130  Biosynthesis of antibiotics
ocg01200  Carbon metabolism
Module
ocg_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ocg_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ocg00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    OCA5_c13350 (sucC1)
   00640 Propanoate metabolism
    OCA5_c13350 (sucC1)
   00660 C5-Branched dibasic acid metabolism
    OCA5_c13350 (sucC1)
Enzymes [BR:ocg01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     OCA5_c13350 (sucC1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 ATP-grasp_5 Ligase_CoA GARS_A CPSase_L_D2
Motif
Other DBs
NCBI-ProteinID: AEI06051
UniProt: B6JGP8
Position
1438683..1439810
Genome map
AA seq 375 aa AA seqDB search
MNLEEHAAKHHVLVPTGVPTPEGRVCKTPEEAAAAVTAIGPSVIKAQVPTGKRGKSGGIK
IAKTADEAASAARDILSMSIGGHRVSQVLVEQLCPIERELYAAVLIDVASRAPLVLFSTE
GGMDIEEVAEKHPDAIRKHVVDIHKGFSAADAAAMLKGLPLGSATEAVGEVLAKLYAIFQ
DKDAELVEINPLAVLKDGRVVALDCKFVLDDSSALRQPDLAKVATPAKMTELEQRGADNG
LKFIQLDGNVGVLANGAGLTMTTMDVIDHFGGRPANFLEIGGEAYTKSEIALDLVLSNPG
VKSLVINFCGAFARTDVMAEGVVKAWETLKPKVPVFFSIHGTGEDEAVKLVRERLGIEPY
DFMEDAVKAAVEAAQ
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgaatcttgaggagcatgcagccaagcatcacgtgctcgtgccgaccggcgttccgacg
cctgagggccgggtctgcaagacgccggaggaagccgcggccgcggtgacggccatcggc
ccgtcggtcatcaaggcgcaggtgccgaccggcaagcgcggcaagtccggcggcatcaag
atcgccaagacggcggatgaagcggcaagcgcggcgcgcgatatcctgtcgatgagcatc
ggcgggcatcgcgtctcgcaggtgctggtcgagcagctctgcccgatcgaacgcgaactc
tatgcagcggttctgatcgacgtcgcgagccgtgcaccgttggtgctgttttcgaccgaa
ggcggcatggatatcgaagaggtggcggagaaacaccccgacgccatccgcaagcatgtc
gtcgacatccacaagggcttcagcgctgccgatgcggcggcgatgctgaaaggcctgccg
ctcggctcggccactgaggccgttggcgaggtgctggcaaagctctacgccatcttccag
gacaaggatgcggagcttgtcgagatcaacccgctcgccgttctgaaggacgggcgcgtg
gtggcgctggactgcaaattcgtgctcgacgattcctccgcgctgcgtcagcccgatctc
gccaaggtggcaacgcccgcgaagatgaccgagcttgaacagcgcggcgccgacaacggc
ctgaagttcatccagctcgacggcaatgtcggcgtgctggcgaacggcgcgggcctcacc
atgaccaccatggatgtcatcgatcattttggcggcaggcccgccaacttcctcgagatc
ggcggcgaggcttacaccaagtcggaaatcgcgctcgatctggtgctgtccaatcccggc
gtcaaaagcctcgtcatcaatttctgcggcgcgttcgcgcgcacggatgtgatggcggaa
ggcgtcgtcaaggcctgggaaacgctgaagccgaaggtgccggtgttcttctcgatccac
ggcaccggtgaggacgaagccgtcaagctggtgcgggagcggcttggcattgaaccttat
gacttcatggaagatgccgtgaaagcggcggtcgaggcagcgcaatga

DBGET integrated database retrieval system