KEGG   Afipia carboxidovorans OM5 (Goettingen): OCA5_c16200
Entry
OCA5_c16200       CDS       T01617                                 
Symbol
trbD
Name
(GenBank) putative conjugal transfer protein TrbD
  KO
K20529  type IV secretion system protein TrbD
Organism
ocg  Afipia carboxidovorans OM5 (Goettingen)
Pathway
ocg02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:ocg00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    OCA5_c16200 (trbD)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ocg02044]
    OCA5_c16200 (trbD)
Secretion system [BR:ocg02044]
 Type IV secretion system
  Trb secretion system protein
   OCA5_c16200 (trbD)
SSDB
Motif
Pfam: VirB3
Other DBs
NCBI-ProteinID: AEI06334
UniProt: B6JHP4
Position
1754035..1754298
AA seq 87 aa
MEEDVRGFFAPVHRALTEPILLGGAPRTVAIANGTLAGAVGLGLRLWIAGLVIWAIGHFA
AIWAAKRDAQFVDVGRRHLRYPAHMDV
NT seq 264 nt   +upstreamnt  +downstreamnt
atggaggaagacgtccgcggcttcttcgcgccggtgcatcgcgcgctcaccgagccgatc
ctgctcggcggtgcgccgcgcacggtcgccatcgccaacggcacgctcgcaggcgcggtc
gggctcggcctgcgcctgtggatcgcgggcctcgtcatctgggcgatcgggcatttcgcc
gcgatatgggcggcgaagcgtgacgcgcagttcgtcgacgtcggccgccggcacctgcgt
tacccggcgcacatggacgtgtga

DBGET integrated database retrieval system